Homologs in group_1121

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06390 FBDBKF_06390 100.0 Morganella morganii S1 exbD TonB system transport protein ExbD
EHELCC_09435 EHELCC_09435 100.0 Morganella morganii S2 exbD TonB system transport protein ExbD
LHKJJB_07940 LHKJJB_07940 100.0 Morganella morganii S3 exbD TonB system transport protein ExbD
HKOGLL_07490 HKOGLL_07490 100.0 Morganella morganii S5 exbD TonB system transport protein ExbD
F4V73_RS15535 F4V73_RS15535 97.9 Morganella psychrotolerans exbD TonB system transport protein ExbD
PMI_RS00145 PMI_RS00145 77.1 Proteus mirabilis HI4320 exbD TonB system transport protein ExbD

Distribution of the homologs in the orthogroup group_1121

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1121

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABV5 6.56e-71 212 71 0 139 3 exbD Biopolymer transport protein ExbD Shigella flexneri
P0ABV2 6.56e-71 212 71 0 139 1 exbD Biopolymer transport protein ExbD Escherichia coli (strain K12)
P0ABV3 6.56e-71 212 71 0 139 3 exbD Biopolymer transport protein ExbD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABV4 6.56e-71 212 71 0 139 3 exbD Biopolymer transport protein ExbD Escherichia coli O157:H7
Q05606 3.73e-64 195 69 1 141 3 exbD Biopolymer transport protein ExbD Pseudomonas putida
P50599 9.28e-21 85 42 5 130 3 tolR Tol-Pal system protein TolR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A0S0 2.03e-20 84 35 2 131 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup C
P0A0R9 2.03e-20 84 35 2 131 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0R8 2.03e-20 84 35 2 131 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O06434 2.49e-20 84 35 3 139 3 exbD Biopolymer transport protein ExbD Neisseria gonorrhoeae
P0C7M0 4.37e-17 75 34 1 128 3 exbD1 Biopolymer transport protein exbD1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLE7 4.37e-17 75 34 1 128 3 exbD1 Biopolymer transport protein exbD1 Xanthomonas campestris pv. campestris (strain B100)
O25898 3.59e-13 65 34 3 113 3 exbD Biopolymer transport protein ExbD Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJP5 4.63e-13 64 34 3 113 3 exbD Biopolymer transport protein ExbD Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZK84 1e-12 63 27 1 118 3 jhp_1057 Putative biopolymer transport protein ExbD-like 1 Helicobacter pylori (strain J99 / ATCC 700824)
O25754 1.1e-12 63 27 1 118 3 HP_1129 Putative biopolymer transport protein ExbD-like 1 Helicobacter pylori (strain ATCC 700392 / 26695)
O67694 1.45e-11 60 29 2 126 3 exbD Biopolymer transport protein ExbD Aquifex aeolicus (strain VF5)
P43009 1.77e-11 61 32 3 129 3 exbD Biopolymer transport protein ExbD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P72203 2.49e-10 58 31 3 122 3 exbD Biopolymer transport protein ExbD Mannheimia haemolytica
P0C7I9 3.94e-10 57 29 2 128 3 exbD2 Biopolymer transport protein exbD2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLE8 3.94e-10 57 29 2 128 3 exbD2 Biopolymer transport protein exbD2 Xanthomonas campestris pv. campestris (strain B100)
Q9RMT1 2.73e-09 55 34 1 126 3 exbD Biopolymer transport protein ExbD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O51809 4.76e-08 51 29 3 129 3 exbD Biopolymer transport protein ExbD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9ZHV9 8.92e-07 48 24 4 139 3 exbD2 Biopolymer transport protein exbD2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43769 1.94e-06 47 33 3 124 1 tolR Tol-Pal system protein TolR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P72942 3.24e-06 48 29 5 131 3 slr0678 Putative biopolymer transport protein ExbD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P64101 0.000147 42 26 3 115 3 HP_1446 Putative biopolymer transport protein ExbD-like 2 Helicobacter pylori (strain ATCC 700392 / 26695)
P64102 0.000147 42 26 3 115 3 jhp_1339 Putative biopolymer transport protein ExbD-like 2 Helicobacter pylori (strain J99 / ATCC 700824)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09815
Feature type CDS
Gene exbD
Product TonB system transport protein ExbD
Location 113884 - 114306 (strand: -1)
Length 423 (nucleotides) / 140 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1121
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02472 Biopolymer transport protein ExbD/TolR

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0848 Intracellular trafficking, secretion, and vesicular transport (U) U Biopolymer transport protein ExbD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03559 biopolymer transport protein ExbD - -

Protein Sequence

MAMRLNEESDDSGELHEINVTPFIDVMLVLLIIFMVAAPLATVDIKVNLPASTAKPQPRPEKPVFLTVKADNQLLVGEQEVTKETLAQILDQTTESNKETTIFFQADKTVDYETLMGIMDALRKAGYLKVGLVGMESAEK

Flanking regions ( +/- flanking 50bp)

GGCTGGGCCGTGATCTCGACCTGGCAGACAGCAAAGCAGGGTAATATCTGATGGCAATGCGTCTTAACGAAGAGTCGGATGACAGCGGCGAATTGCATGAAATTAACGTCACACCTTTTATTGATGTGATGTTGGTTCTGCTGATCATCTTTATGGTGGCCGCACCGCTGGCGACCGTTGATATTAAAGTGAATCTGCCGGCCTCAACGGCAAAACCACAGCCGCGTCCGGAAAAACCGGTCTTCCTGACGGTGAAAGCAGATAACCAGCTGCTGGTGGGCGAGCAGGAAGTCACAAAAGAAACACTGGCTCAGATCCTGGATCAGACCACGGAATCCAATAAGGAAACCACGATCTTCTTCCAGGCAGATAAAACAGTCGATTATGAAACGCTGATGGGCATTATGGATGCTCTGCGCAAAGCGGGATATCTGAAAGTCGGGTTAGTGGGTATGGAGTCGGCGGAGAAATAATCATCCGCAGCCTGAAATGAAAAAAGCCGTTCATGATGAACGGCTTTTTT