Homologs in group_1115

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06360 FBDBKF_06360 100.0 Morganella morganii S1 ubiK Ubiquinone biosynthesis accessory factor UbiK
EHELCC_09405 EHELCC_09405 100.0 Morganella morganii S2 ubiK Ubiquinone biosynthesis accessory factor UbiK
LHKJJB_07970 LHKJJB_07970 100.0 Morganella morganii S3 ubiK Ubiquinone biosynthesis accessory factor UbiK
HKOGLL_07520 HKOGLL_07520 100.0 Morganella morganii S5 ubiK Ubiquinone biosynthesis accessory factor UbiK
F4V73_RS15565 F4V73_RS15565 94.2 Morganella psychrotolerans - accessory factor UbiK family protein
PMI_RS11645 PMI_RS11645 70.9 Proteus mirabilis HI4320 - accessory factor UbiK family protein

Distribution of the homologs in the orthogroup group_1115

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1115

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZLY9 1.59e-35 119 73 0 79 1 ubiK Ubiquinone biosynthesis accessory factor UbiK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q46868 8.42e-34 114 67 0 82 1 ubiK Ubiquinone biosynthesis accessory factor UbiK Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09785
Feature type CDS
Gene ubiK
Product Ubiquinone biosynthesis accessory factor UbiK
Location 106126 - 106386 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1115
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04380 Membrane fusogenic activity

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2960 Coenzyme transport and metabolism (H) H Ubiquinone biosynthesis accessory factor UbiK

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09806 ubiquinone biosynthesis accessory factor UbiK - -

Protein Sequence

MIDPKKIEQIATQLQSALPKGVREIGADIDKKMRAILQSQLGKLDLVNREEFDVQTQVLLRTREKLSQMEKRLAELEARLAEKGGE

Flanking regions ( +/- flanking 50bp)

CAGGTTACTATTTGCGGCATAACGATCCTCCGGCTCAGAAAGGAAAAATCATGATTGACCCGAAAAAAATTGAACAGATTGCCACACAGCTGCAAAGCGCGCTGCCGAAAGGTGTGCGGGAGATCGGAGCGGATATCGATAAAAAGATGCGTGCCATTTTACAGTCACAGCTCGGCAAGCTGGATTTAGTCAACCGCGAAGAGTTTGATGTGCAGACTCAGGTGCTGCTGCGCACCCGCGAAAAACTGTCGCAGATGGAAAAACGTCTGGCAGAGCTGGAAGCGCGCCTGGCGGAAAAAGGCGGCGAGTAATGACAACAGGAGATACGCCGTGCGTATCTCCTGCATAATCAGCCGGTTAC