Homologs in group_1173

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06335 FBDBKF_06335 100.0 Morganella morganii S1 ygiB DUF1190 domain-containing protein
EHELCC_09380 EHELCC_09380 100.0 Morganella morganii S2 ygiB DUF1190 domain-containing protein
LHKJJB_07995 LHKJJB_07995 100.0 Morganella morganii S3 ygiB DUF1190 domain-containing protein
HKOGLL_07545 HKOGLL_07545 100.0 Morganella morganii S5 ygiB DUF1190 domain-containing protein
F4V73_RS15585 F4V73_RS15585 92.4 Morganella psychrotolerans - DUF1190 family protein
PMI_RS11625 PMI_RS11625 68.3 Proteus mirabilis HI4320 - DUF1190 family protein

Distribution of the homologs in the orthogroup group_1173

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1173

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N0D4 2.56e-112 324 71 2 221 3 plu3956 UPF0441 protein plu3956 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2U1E4 2.54e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0TD68 2.71e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q31WZ5 3.45e-108 313 68 3 225 3 ygiB UPF0441 protein YgiB Shigella boydii serotype 4 (strain Sb227)
Q3YXK4 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Shigella sonnei (strain Ss046)
P0ADT4 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Shigella flexneri
Q0T0M1 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Shigella flexneri serotype 5b (strain 8401)
Q1R6U6 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain UTI89 / UPEC)
B1LF30 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain SMS-3-5 / SECEC)
B6I408 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain SE11)
P0ADT2 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain K12)
P0ADT3 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFV9 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O1:K1 / APEC
A8A4J3 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O9:H4 (strain HS)
C4ZQV5 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain K12 / MC4100 / BW2952)
B5YR82 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBP4 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O157:H7
B7UIU7 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRR9 4.34e-108 313 69 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli O139:H28 (strain E24377A / ETEC)
B4T657 6.1e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella newport (strain SL254)
Q7CPS1 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ1 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella typhi
B4TVR9 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella schwarzengrund (strain CVM19633)
C0PYV8 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella paratyphi C (strain RKS4594)
A9N5W3 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FV55 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella dublin (strain CT_02021853)
Q57JS5 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella choleraesuis (strain SC-B67)
B5F680 6.37e-108 312 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella agona (strain SL483)
B1ISC0 1.03e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B4TI37 1.05e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella heidelberg (strain SL476)
B5QZ24 2.17e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella enteritidis PT4 (strain P125109)
B5BFZ9 2.62e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella paratyphi A (strain AKU_12601)
Q5PMT8 2.62e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MPX4 2.62e-107 311 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32BU3 6.56e-107 310 68 3 225 3 ygiB UPF0441 protein YgiB Shigella dysenteriae serotype 1 (strain Sd197)
B5REE6 9.7e-103 299 68 3 225 3 ygiB UPF0441 protein YgiB Salmonella gallinarum (strain 287/91 / NCTC 13346)
A6TE25 1.17e-100 294 69 0 223 3 KPN78578_33850 UPF0441 protein KPN78578_33850 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7CGH1 2.96e-100 293 66 4 229 3 YPO0661 UPF0441 protein YPO0661/y3517/YP_2976 Yersinia pestis
Q1CMC8 2.96e-100 293 66 4 229 3 YPN_0520 UPF0441 protein YPN_0520 Yersinia pestis bv. Antiqua (strain Nepal516)
Q665V9 2.96e-100 293 66 4 229 3 YPTB3401 UPF0441 protein YPTB3401 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C380 2.96e-100 293 66 4 229 3 YPA_3130 UPF0441 protein YPA_3130 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JQU7 3.1e-100 293 65 3 231 3 YE3666 UPF0441 protein YE3666 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5XU47 9.28e-100 291 68 0 223 3 KPK_0672 UPF0441 protein KPK_0672 Klebsiella pneumoniae (strain 342)
B2VGH5 5.12e-97 285 67 3 226 3 ETA_04310 UPF0441 protein ETA_04310 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NWD5 7.01e-96 281 62 3 223 3 SG0265 UPF0441 protein SG0265 Sodalis glossinidius (strain morsitans)
A8APS2 4.44e-95 280 69 2 224 3 CKO_04429 UPF0441 protein CKO_04429 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GJS8 2.23e-93 275 71 2 209 3 Spro_4274 UPF0441 protein Spro_4274 Serratia proteamaculans (strain 568)
Q6DAC6 2.17e-90 268 70 2 209 3 ECA0329 UPF0441 protein ECA0329 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIS1 5.75e-90 267 69 3 213 3 PC1_0312 UPF0441 protein PC1_0312 Pectobacterium carotovorum subsp. carotovorum (strain PC1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09760
Feature type CDS
Gene ygiB
Product DUF1190 domain-containing protein
Location 102133 - 102810 (strand: 1)
Length 678 (nucleotides) / 225 (amino acids)
In genomic island -

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1173
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06693 Protein of unknown function (DUF1190)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5463 Function unknown (S) S Uncharacterized conserved protein YgiB, UPF0441/DUF1190 family, involved in bioifilm formation

Protein Sequence

MTMKRTKNINRDAFRKTWRQYRLAPVAAAVGAVLMLTACDEADETVALYTTAEQCSAANPSQAGECTTAYNNALEEAAKTAPKYATREDCVAEFGEAQCTQAPTELANNSQQQQPAQASGSFWMPLMAGYMMGRMMGGGAAASQPLFTSRNPASPANGKFVDATGKNYGSATGGRSMTVPKTAMAPKPATTTTTTRGGFGDSVAKQNTMQRSSGSSNSSSRSMGG

Flanking regions ( +/- flanking 50bp)

ATCCTAGACAGTAATTACCTCCCCTGAAACCGTTTCCGGATATAACGACGATGACAATGAAACGCACCAAGAATATTAACCGCGACGCTTTCCGCAAAACCTGGCGTCAGTACCGCCTGGCACCTGTTGCGGCTGCTGTCGGCGCTGTTCTGATGTTAACCGCCTGCGATGAAGCCGATGAAACCGTTGCGCTCTACACCACCGCAGAGCAGTGCTCCGCCGCGAACCCGTCACAGGCCGGTGAATGTACCACTGCCTATAACAACGCACTGGAAGAAGCAGCAAAAACCGCACCGAAATATGCCACCCGCGAAGACTGCGTGGCGGAATTCGGTGAAGCCCAGTGTACTCAGGCACCAACAGAGCTGGCGAATAACAGCCAGCAGCAGCAACCTGCCCAGGCATCCGGCAGCTTCTGGATGCCGCTGATGGCCGGTTATATGATGGGCCGTATGATGGGCGGCGGTGCCGCTGCTTCTCAGCCGCTGTTCACTTCCCGTAACCCGGCAAGCCCGGCTAACGGCAAGTTTGTTGATGCCACCGGTAAAAACTACGGTTCTGCCACCGGCGGACGCAGCATGACAGTACCGAAAACCGCCATGGCACCAAAACCGGCCACCACAACCACCACCACACGCGGTGGCTTCGGTGACAGCGTGGCGAAACAGAACACCATGCAGCGCTCATCCGGCAGCAGCAATTCATCTTCCCGTTCAATGGGCGGCTGATTTACATGAAACGCGTAGCGATTAGCGAGCGCCCTGACTGGCGCGGGAAA