Homologs in group_1173

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06335 FBDBKF_06335 92.4 Morganella morganii S1 ygiB DUF1190 domain-containing protein
EHELCC_09380 EHELCC_09380 92.4 Morganella morganii S2 ygiB DUF1190 domain-containing protein
NLDBIP_09760 NLDBIP_09760 92.4 Morganella morganii S4 ygiB DUF1190 domain-containing protein
LHKJJB_07995 LHKJJB_07995 92.4 Morganella morganii S3 ygiB DUF1190 domain-containing protein
HKOGLL_07545 HKOGLL_07545 92.4 Morganella morganii S5 ygiB DUF1190 domain-containing protein
PMI_RS11625 PMI_RS11625 63.9 Proteus mirabilis HI4320 - DUF1190 family protein

Distribution of the homologs in the orthogroup group_1173

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1173

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N0D4 3.26e-105 306 67 3 234 3 plu3956 UPF0441 protein plu3956 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4T657 7.52e-105 305 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella newport (strain SL254)
A9MPX4 1.99e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CPS1 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ1 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella typhi
B4TVR9 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella schwarzengrund (strain CVM19633)
C0PYV8 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella paratyphi C (strain RKS4594)
A9N5W3 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FV55 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella dublin (strain CT_02021853)
Q57JS5 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella choleraesuis (strain SC-B67)
B5F680 2.54e-104 303 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella agona (strain SL483)
B4TI37 4.89e-104 302 66 3 227 3 ygiB UPF0441 protein YgiB Salmonella heidelberg (strain SL476)
B5QZ24 8.36e-104 302 65 3 227 3 ygiB UPF0441 protein YgiB Salmonella enteritidis PT4 (strain P125109)
B2U1E4 1.06e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5BFZ9 1.06e-103 301 65 3 227 3 ygiB UPF0441 protein YgiB Salmonella paratyphi A (strain AKU_12601)
Q5PMT8 1.06e-103 301 65 3 227 3 ygiB UPF0441 protein YgiB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q31WZ5 1.37e-103 301 65 3 227 3 ygiB UPF0441 protein YgiB Shigella boydii serotype 4 (strain Sb227)
Q3YXK4 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Shigella sonnei (strain Ss046)
P0ADT4 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Shigella flexneri
Q0T0M1 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Shigella flexneri serotype 5b (strain 8401)
Q1R6U6 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain UTI89 / UPEC)
B1LF30 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain SMS-3-5 / SECEC)
B6I408 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain SE11)
P0ADT2 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain K12)
P0ADT3 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFV9 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O1:K1 / APEC
A8A4J3 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O9:H4 (strain HS)
C4ZQV5 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain K12 / MC4100 / BW2952)
B5YR82 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBP4 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O157:H7
B7UIU7 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRR9 1.61e-103 301 66 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O139:H28 (strain E24377A / ETEC)
B1ISC0 4.46e-103 300 65 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD68 9.19e-103 299 65 3 227 3 ygiB UPF0441 protein YgiB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32BU3 1.21e-102 299 65 3 227 3 ygiB UPF0441 protein YgiB Shigella dysenteriae serotype 1 (strain Sd197)
B5REE6 5.23e-99 290 65 3 227 3 ygiB UPF0441 protein YgiB Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q7CGH1 2.61e-97 286 66 5 232 3 YPO0661 UPF0441 protein YPO0661/y3517/YP_2976 Yersinia pestis
Q1CMC8 2.61e-97 286 66 5 232 3 YPN_0520 UPF0441 protein YPN_0520 Yersinia pestis bv. Antiqua (strain Nepal516)
Q665V9 2.61e-97 286 66 5 232 3 YPTB3401 UPF0441 protein YPTB3401 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C380 2.61e-97 286 66 5 232 3 YPA_3130 UPF0441 protein YPA_3130 Yersinia pestis bv. Antiqua (strain Antiqua)
Q2NWD5 1.03e-95 281 61 3 225 3 SG0265 UPF0441 protein SG0265 Sodalis glossinidius (strain morsitans)
A6TE25 1.33e-94 278 67 3 227 3 KPN78578_33850 UPF0441 protein KPN78578_33850 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JQU7 8.49e-94 277 65 4 232 3 YE3666 UPF0441 protein YE3666 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5XU47 9.21e-94 276 66 3 227 3 KPK_0672 UPF0441 protein KPK_0672 Klebsiella pneumoniae (strain 342)
B2VGH5 6.2e-90 267 63 3 228 3 ETA_04310 UPF0441 protein ETA_04310 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8APS2 1.06e-89 266 66 3 227 3 CKO_04429 UPF0441 protein CKO_04429 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GJS8 3.02e-89 265 68 3 213 3 Spro_4274 UPF0441 protein Spro_4274 Serratia proteamaculans (strain 568)
Q6DAC6 3.9e-86 257 66 2 213 3 ECA0329 UPF0441 protein ECA0329 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIS1 9.24e-86 256 66 2 213 3 PC1_0312 UPF0441 protein PC1_0312 Pectobacterium carotovorum subsp. carotovorum (strain PC1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15585
Feature type CDS
Gene -
Product DUF1190 family protein
Location 111838 - 112521 (strand: -1)
Length 684 (nucleotides) / 227 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1173
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06693 Protein of unknown function (DUF1190)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5463 Function unknown (S) S Uncharacterized conserved protein YgiB, UPF0441/DUF1190 family, involved in bioifilm formation

Protein Sequence

MTIKRTKNINRDAFRKTWRQYRLAPVAAAVGAVLMLAACDEADETVALYTTAEQCTTANPGQAGECTTAYNNAVQEAVKTAPKYATREDCVAEFGESQCTQAQVPTELANNNQTQQQEPAQASGGFWMPLMAGYMMGRMMGGGAASQPLFTSRNAASPANGKFVDAGGKNYGSATGGRSVSVPKTAMAPKPATTTTTTRGGFGDSVAKQNSMQRSSGSSSSSRSMGG

Flanking regions ( +/- flanking 50bp)

ATCCTAGTCAGTAATTACCTCTCATGAAACCGTTTCCGGATATAACGACAATGACAATAAAACGCACAAAAAATATTAACCGCGACGCTTTCCGTAAAACCTGGCGTCAATATCGCTTAGCCCCTGTTGCTGCCGCAGTTGGTGCAGTCCTGATGCTGGCTGCCTGTGATGAAGCCGATGAAACCGTCGCGCTCTATACCACAGCAGAACAGTGCACAACAGCAAACCCGGGACAGGCCGGTGAATGTACCACTGCATACAATAATGCCGTTCAGGAAGCGGTAAAAACCGCCCCGAAATATGCAACCCGCGAAGATTGCGTGGCTGAGTTCGGTGAATCCCAGTGTACTCAGGCTCAGGTGCCTACTGAGCTGGCAAATAATAACCAGACTCAGCAACAAGAGCCTGCACAGGCTTCCGGTGGTTTCTGGATGCCGCTGATGGCCGGTTACATGATGGGCCGTATGATGGGCGGCGGTGCTGCATCCCAGCCACTGTTTACCTCACGTAATGCGGCAAGCCCGGCAAACGGTAAGTTTGTCGACGCAGGCGGTAAAAACTACGGCTCCGCAACCGGCGGACGCTCTGTATCCGTACCAAAAACAGCAATGGCGCCAAAACCGGCTACCACCACAACCACGACCCGTGGCGGATTTGGTGACAGTGTTGCCAAACAAAACTCAATGCAGCGCTCATCCGGCAGCAGTTCTTCTTCACGCTCAATGGGCGGCTGATTTGTCATGAAACGAGTCCCGATTAGCGAGCGCCCGGACTGGCGTGAGAA