Homologs in group_740

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03275 FBDBKF_03275 100.0 Morganella morganii S1 rnk nucleoside diphosphate kinase regulator
EHELCC_07260 EHELCC_07260 100.0 Morganella morganii S2 rnk nucleoside diphosphate kinase regulator
LHKJJB_07120 LHKJJB_07120 100.0 Morganella morganii S3 rnk nucleoside diphosphate kinase regulator
HKOGLL_03810 HKOGLL_03810 100.0 Morganella morganii S5 rnk nucleoside diphosphate kinase regulator
F4V73_RS11645 F4V73_RS11645 81.6 Morganella psychrotolerans rnk nucleoside diphosphate kinase regulator
PMI_RS18125 PMI_RS18125 76.5 Proteus mirabilis HI4320 rnk nucleoside diphosphate kinase regulator

Distribution of the homologs in the orthogroup group_740

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_740

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFW7 1.32e-59 183 66 0 133 3 rnk Regulator of nucleoside diphosphate kinase Shigella flexneri
P0AFW4 1.32e-59 183 66 0 133 1 rnk Regulator of nucleoside diphosphate kinase Escherichia coli (strain K12)
P0AFW5 1.32e-59 183 66 0 133 3 rnk Regulator of nucleoside diphosphate kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFW6 1.32e-59 183 66 0 133 3 rnk Regulator of nucleoside diphosphate kinase Escherichia coli O157:H7
Q7VJT9 8.51e-11 59 33 2 107 3 greA Transcription elongation factor GreA Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B3EPH3 2.72e-07 50 31 3 108 3 greA Transcription elongation factor GreA Chlorobium phaeobacteroides (strain BS1)
B9KDP9 3.26e-07 50 32 1 96 3 greA Transcription elongation factor GreA Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q5HWI0 1.16e-06 48 31 2 108 3 greA Transcription elongation factor GreA Campylobacter jejuni (strain RM1221)
Q9PIK9 1.16e-06 48 31 2 108 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FK75 1.16e-06 48 31 2 108 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A1VY10 2.28e-06 47 31 2 108 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
B2USW4 4.69e-06 47 29 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain Shi470)
C4XLU8 4.94e-06 47 29 1 120 3 greA Transcription elongation factor GreA Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B4S9B2 5.88e-06 46 29 2 97 3 greA Transcription elongation factor GreA Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A6Q4L2 6.36e-06 46 30 2 108 3 greA Transcription elongation factor GreA Nitratiruptor sp. (strain SB155-2)
A7H585 8.18e-06 46 30 2 108 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B8IZM4 8.53e-06 46 35 0 64 3 greA Transcription elongation factor GreA Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
P64275 1.05e-05 45 28 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain ATCC 700392 / 26695)
P64276 1.05e-05 45 28 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain J99 / ATCC 700824)
Q0B0N4 1.08e-05 45 32 2 84 3 greA Transcription elongation factor GreA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2LR03 1.27e-05 45 34 0 61 3 greA Transcription elongation factor GreA Syntrophus aciditrophicus (strain SB)
Q1CT06 1.82e-05 45 28 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain HPAG1)
B5Z7M6 1.82e-05 45 28 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain G27)
B6JM90 1.82e-05 45 28 1 94 3 greA Transcription elongation factor GreA Helicobacter pylori (strain P12)
A4SFN0 2.45e-05 44 30 3 107 3 greA Transcription elongation factor GreA Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A8ESG0 2.67e-05 44 30 4 126 3 greA Transcription elongation factor GreA Aliarcobacter butzleri (strain RM4018)
A0M5U7 4.89e-05 43 28 0 74 3 greA Transcription elongation factor GreA Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q17WJ3 6.39e-05 43 28 1 94 3 greA Transcription elongation factor GreA Helicobacter acinonychis (strain Sheeba)
B3QPT8 6.63e-05 43 32 1 83 3 greA Transcription elongation factor GreA Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1BHJ3 6.7e-05 43 30 2 107 3 greA Transcription elongation factor GreA Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B9L822 7.82e-05 43 30 2 104 3 greA Transcription elongation factor GreA Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q97EB6 8.45e-05 43 28 1 91 3 greA Transcription elongation factor GreA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B4SBF9 8.55e-05 43 28 3 107 3 greA Transcription elongation factor GreA Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B5YJG9 9.55e-05 43 25 1 92 3 greA Transcription elongation factor GreA Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8KCH5 9.55e-05 43 29 3 107 3 greA Transcription elongation factor GreA Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B2IHJ7 0.000104 43 25 1 121 3 greA Transcription elongation factor GreA Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q3A452 0.000111 43 26 3 94 3 greA Transcription elongation factor GreA Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9K7Y7 0.000112 43 33 2 87 3 greA Transcription elongation factor GreA Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B2S1W7 0.000118 43 28 1 92 3 greA Transcription elongation factor GreA Treponema pallidum subsp. pallidum (strain SS14)
O83063 0.000118 43 28 1 92 3 greA Transcription elongation factor GreA Treponema pallidum (strain Nichols)
B3EE12 0.000154 42 29 3 107 3 greA Transcription elongation factor GreA Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A0LK20 0.000219 42 29 0 81 3 greA Transcription elongation factor GreA Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B0S216 0.000228 42 33 0 75 3 greA Transcription elongation factor GreA Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q04EK0 0.000237 42 24 1 101 3 greA Transcription elongation factor GreA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q65GT4 0.000242 42 26 1 99 3 greA Transcription elongation factor GreA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9E6Y8 0.00025 42 33 0 71 3 greA Transcription elongation factor GreA Macrococcus caseolyticus (strain JCSC5402)
B0U8M0 0.00026 42 25 1 122 3 greA Transcription elongation factor GreA Methylobacterium sp. (strain 4-46)
Q9X232 0.000281 42 33 1 77 3 greA Transcription elongation factor GreA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5ILE7 0.000293 42 33 1 77 3 greA Transcription elongation factor GreA Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q8ZJH2 0.0003 42 30 2 95 3 greB Transcription elongation factor GreB Yersinia pestis
Q3Z8E7 0.000327 41 25 0 81 3 greA Transcription elongation factor GreA Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A1V9Q2 0.000341 41 30 1 102 3 greA Transcription elongation factor GreA Nitratidesulfovibrio vulgaris (strain DP4)
Q725M4 0.000341 41 30 1 102 3 greA Transcription elongation factor GreA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8G358 0.00037 41 32 3 112 3 greA Transcription elongation factor GreA Chloroflexus aggregans (strain MD-66 / DSM 9485)
A9BFC0 0.00051 41 25 1 88 3 greA Transcription elongation factor GreA Petrotoga mobilis (strain DSM 10674 / SJ95)
B8IBN8 0.000526 41 24 1 122 3 greA Transcription elongation factor GreA Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q817Z6 0.00063 40 25 1 99 3 greA Transcription elongation factor GreA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B2UXU9 0.000747 40 25 0 81 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Alaska E43 / Type E3)
Q3ATA7 0.000802 40 29 2 96 3 greA Transcription elongation factor GreA Chlorobium chlorochromatii (strain CaD3)
Q6HDE6 0.000802 40 30 0 65 3 greA Transcription elongation factor GreA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634G5 0.000802 40 30 0 65 3 greA Transcription elongation factor GreA Bacillus cereus (strain ZK / E33L)
Q81LK9 0.000802 40 30 0 65 3 greA Transcription elongation factor GreA Bacillus anthracis
C3L5Y5 0.000802 40 30 0 65 3 greA Transcription elongation factor GreA Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P968 0.000802 40 30 0 65 3 greA Transcription elongation factor GreA Bacillus anthracis (strain A0248)
Q9KDD7 0.000835 40 26 2 108 3 greA Transcription elongation factor GreA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7M9N2 0.000842 40 29 3 100 3 greA Transcription elongation factor GreA Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6AL57 0.001 40 27 0 81 3 greA Transcription elongation factor GreA Desulfotalea psychrophila (strain LSv54 / DSM 12343)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07585
Feature type CDS
Gene rnk
Product nucleoside diphosphate kinase regulator
Location 192191 - 192601 (strand: -1)
Length 411 (nucleotides) / 136 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_740
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01272 Transcription elongation factor, GreA/GreB, C-term
PF14760 Rnk N-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0782 Transcription (K) K Transcription elongation factor, GreA/GreB family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06140 regulator of nucleoside diphosphate kinase - -

Protein Sequence

MKKPNIIINELDAERLDMLLEQPAYADSPVAEALNEELDRAEILPPAEMPATVVTMNSRIRFEDLSSGKESIRTLVYPASLKDSAEQLSVMAPLGAALLGLSVGDEISWELPNGEATRVKVSEIIYQPEAAGELHR

Flanking regions ( +/- flanking 50bp)

CTTCTGGTGTGGGGGTGTTCTTTTGTATTGGAAATGATTTGGAGTGTGGTATGAAAAAGCCCAATATAATTATTAATGAACTGGACGCGGAGCGTCTGGATATGCTGCTGGAACAGCCGGCTTATGCTGACAGTCCGGTTGCCGAAGCCCTGAATGAAGAGTTAGATCGCGCGGAAATCCTGCCGCCGGCAGAAATGCCTGCCACGGTCGTGACGATGAACAGCCGCATCCGCTTTGAAGATTTATCAAGCGGGAAAGAGAGTATCCGTACCCTGGTGTACCCGGCTTCACTGAAAGACAGTGCTGAACAGCTGTCTGTGATGGCACCACTGGGAGCTGCGTTACTCGGGCTTTCTGTCGGTGATGAGATCTCATGGGAACTGCCGAACGGTGAAGCAACGCGCGTAAAAGTATCAGAAATTATCTATCAGCCTGAAGCTGCCGGTGAGTTACACCGTTAATCCGCTTTAAGCCGGTTCTGCGTCCGTTTCAGGCAATCTGCGGGCGCAGC