Homologs in group_2630

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03460 FBDBKF_03460 100.0 Morganella morganii S1 livF high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF
EHELCC_07075 EHELCC_07075 100.0 Morganella morganii S2 livF high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF
LHKJJB_06935 LHKJJB_06935 100.0 Morganella morganii S3 livF high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF
HKOGLL_03995 HKOGLL_03995 100.0 Morganella morganii S5 livF high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF
F4V73_RS11435 F4V73_RS11435 94.0 Morganella psychrotolerans livF high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF

Distribution of the homologs in the orthogroup group_2630

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2630

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22731 1.24e-133 378 79 0 233 1 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Escherichia coli (strain K12)
P0A191 6.49e-132 374 78 0 233 3 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A192 6.49e-132 374 78 0 233 3 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Salmonella typhi
P21630 2.01e-117 337 73 0 233 3 braG High-affinity branched-chain amino acid transport ATP-binding protein BraG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q58664 4.31e-60 192 41 1 233 3 livF Probable branched-chain amino acid transport ATP-binding protein LivF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28882 2.94e-47 159 37 1 233 3 livF Probable branched-chain amino acid transport ATP-binding protein LivF Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P45073 3.46e-35 128 32 1 234 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q58663 9.47e-35 127 30 3 250 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P33982 3.55e-34 126 33 4 231 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O28881 1.42e-33 124 30 2 246 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P0A9V4 1.46e-32 121 32 3 235 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 1.46e-32 121 32 3 235 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 1.46e-32 121 32 3 235 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 1.46e-32 121 32 3 235 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
P24693 4.38e-32 120 33 2 208 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Acidithiobacillus ferridurans
P23703 4.49e-32 122 36 3 222 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P10346 2.64e-31 118 30 2 226 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q6MCV4 6e-31 120 32 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
P72335 7.03e-31 118 34 2 221 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q1BWI2 2.14e-30 117 33 4 225 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q04G50 2.28e-30 118 33 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8KLG1 2.68e-30 117 34 4 222 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P25885 3.95e-30 115 31 2 228 3 R00382 Uncharacterized ABC transporter ATP-binding protein R00382 Rhizobium meliloti (strain 1021)
Q39GT7 4.07e-30 116 32 2 224 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P0A193 9.07e-30 114 32 3 249 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 9.07e-30 114 32 3 249 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
P21629 2.14e-29 113 31 4 249 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KUI0 2.33e-29 115 32 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8GNH6 3.62e-29 114 34 3 222 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
P45092 4.01e-29 112 35 4 217 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3MGT2 4.06e-29 112 32 7 246 3 phnC Phosphonates import ATP-binding protein PhnC Trichormus variabilis (strain ATCC 29413 / PCC 7937)
O52618 5.11e-29 114 34 4 227 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
P63374 6.83e-29 112 33 7 234 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63373 6.83e-29 112 33 7 234 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0AAF9 7.72e-29 111 33 5 237 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 7.72e-29 111 33 5 237 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 7.72e-29 111 33 5 237 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 7.72e-29 111 33 5 237 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
P55476 1.52e-28 113 33 2 221 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A9S9 2.03e-28 110 32 5 250 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 2.03e-28 110 32 5 250 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 2.03e-28 110 32 5 250 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P94440 2.05e-28 112 33 4 214 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q7MJ01 2.51e-28 110 33 4 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain YJ016)
Q8DAV6 2.51e-28 110 33 4 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain CMCP6)
A0LUE6 2.6e-28 113 34 6 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P94374 3.93e-28 111 32 4 213 2 yxlF Uncharacterized ABC transporter ATP-binding protein YxlF Bacillus subtilis (strain 168)
Q8YUI9 5.98e-28 109 31 7 238 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q13ZJ1 6.72e-28 110 35 3 225 3 nodI Nod factor export ATP-binding protein I Paraburkholderia xenovorans (strain LB400)
Q160M2 9.15e-28 111 35 6 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q18C09 1.06e-27 110 31 5 229 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q2JB14 1.56e-27 108 32 4 246 3 phnC Phosphonates import ATP-binding protein PhnC Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q10V16 1.78e-27 108 33 6 243 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q8DU24 1.91e-27 108 35 9 219 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q87R20 2.36e-27 107 33 4 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q02R79 2.49e-27 110 35 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HY19 2.54e-27 110 35 6 217 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54537 3.1e-27 107 28 2 232 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q13VD7 3.19e-27 109 33 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q1M7W6 3.5e-27 108 33 3 222 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6HFB5 5.25e-27 107 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus thuringiensis subsp. konkukian (strain 97-27)
P50332 5.61e-27 108 33 2 214 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
Q98HF7 5.63e-27 109 32 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P56344 5.87e-27 106 32 4 218 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q7VM95 6.8e-27 108 32 5 221 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8K449 7.97e-27 111 31 4 219 1 Abca9 ATP-binding cassette sub-family A member 9 Mus musculus
Q8K449 2.59e-11 66 26 4 199 1 Abca9 ATP-binding cassette sub-family A member 9 Mus musculus
Q4QP85 8.13e-27 108 32 7 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q03PF2 8.17e-27 108 31 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q12R52 8.26e-27 106 31 5 238 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q73F11 9.26e-27 108 32 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3A9G5 1.02e-26 108 31 7 235 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P46342 1.13e-26 106 30 6 234 3 pstB1 Phosphate import ATP-binding protein PstB 1 Bacillus subtilis (strain 168)
A0PY57 1.14e-26 108 31 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q578K3 1.42e-26 108 34 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 1.42e-26 108 34 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q637E2 1.44e-26 106 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ZK / E33L)
A0A0H2ZLL3 1.47e-26 105 34 5 217 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8YCG3 1.59e-26 108 34 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8U4K3 1.65e-26 107 32 5 215 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q81ZF5 1.68e-26 107 31 5 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q8FVV5 1.74e-26 107 34 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q6HP89 1.8e-26 107 31 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
O31339 1.98e-26 107 30 4 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q733D6 2.29e-26 105 30 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1QE80 2.4e-26 108 30 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q81VM2 2.57e-26 107 32 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q2K8C8 3.16e-26 107 33 4 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2SVP3 3.26e-26 106 31 3 225 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q81IN8 3.32e-26 107 31 5 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P77795 3.46e-26 107 30 6 235 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
Q63H29 3.51e-26 107 31 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q8ELQ6 3.53e-26 107 31 5 221 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q87S48 3.72e-26 105 31 7 224 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q73EL7 3.72e-26 106 31 5 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
P63363 4.09e-26 105 31 8 247 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WT3 4.09e-26 105 31 8 247 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serotype 4b (strain F2365)
P63364 4.09e-26 105 31 8 247 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q63TX3 4.18e-26 105 31 3 225 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q63GR8 4.21e-26 106 31 5 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
P26050 4.33e-26 105 32 3 222 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3JSQ0 4.36e-26 105 31 3 225 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 4.36e-26 105 31 3 225 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q8XXY9 4.59e-26 106 30 3 226 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5FM18 4.67e-26 105 32 8 234 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1LKJ2 4.81e-26 105 32 3 226 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q03AH0 5.09e-26 106 30 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P08720 5.19e-26 105 32 3 222 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
A1VZQ5 5.77e-26 104 29 3 234 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P9X7 6.35e-26 103 29 3 234 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q47T99 6.44e-26 107 32 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q5HIL5 6.49e-26 106 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 6.49e-26 106 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 6.49e-26 106 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
P44513 6.5e-26 106 31 7 231 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8EBC3 6.65e-26 106 30 4 217 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O34900 6.7e-26 104 30 3 227 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q52666 7.11e-26 104 26 3 225 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q63S19 7.68e-26 105 32 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 7.68e-26 105 32 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 7.68e-26 105 32 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q7NWX3 8.61e-26 106 34 5 218 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
O57896 9.78e-26 105 33 6 218 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q4QMH4 9.98e-26 105 30 6 246 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q5YRD1 1.03e-25 105 32 7 222 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q81Y10 1.03e-25 103 30 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus anthracis
Q0SY86 1.05e-25 107 31 4 221 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q0SY86 1.44e-15 78 26 5 214 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q83J33 1.07e-25 107 31 4 221 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q83J33 9.11e-16 79 26 5 214 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q3JYY5 1.1e-25 103 31 6 227 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q38VW6 1.1e-25 105 31 6 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
P63372 1.13e-25 103 31 6 227 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63371 1.13e-25 103 31 6 227 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype III (strain NEM316)
Q81IZ6 1.23e-25 105 31 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q92WJ0 1.25e-25 105 32 4 216 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q5LBT4 1.38e-25 107 32 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64SQ6 1.52e-25 106 32 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q8A883 1.56e-25 106 33 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P44785 1.72e-25 105 30 6 246 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5WET7 1.85e-25 103 30 8 246 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shouchella clausii (strain KSM-K16)
Q6GJL2 1.86e-25 105 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q1MMZ3 1.94e-25 103 29 7 249 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A1B9Q7 1.99e-25 105 33 7 236 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paracoccus denitrificans (strain Pd 1222)
Q6D201 2.01e-25 104 29 5 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q88ZJ6 2.03e-25 105 31 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q52815 2.13e-25 103 27 3 225 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8NY21 2.19e-25 104 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 2.19e-25 104 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q5ZWE4 2.22e-25 105 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8UH62 2.24e-25 104 29 6 237 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
P32010 2.28e-25 104 33 3 217 1 drrA Daunorubicin/doxorubicin resistance ATP-binding protein DrrA Streptomyces peucetius
P27675 2.29e-25 102 27 4 227 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q81A96 2.31e-25 103 30 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5WXF0 2.43e-25 105 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
P63368 2.5e-25 102 31 9 235 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63367 2.5e-25 102 31 9 235 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype III (strain NEM316)
Q3K199 2.5e-25 102 31 9 235 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8X5Q4 2.54e-25 106 32 2 231 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q8X5Q4 4.56e-16 80 29 3 217 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q7NQN5 2.56e-25 104 35 6 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P37774 2.6e-25 102 30 6 236 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q9G4F5 2.85e-25 104 30 5 239 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
P44871 3.34e-25 101 33 5 219 3 ftsE Cell division ATP-binding protein FtsE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45769 3.6e-25 102 28 3 218 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q1B8V9 3.74e-25 104 30 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 3.74e-25 104 30 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q5X627 4.06e-25 104 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
P33360 4.23e-25 103 30 5 238 1 yehX Glycine betaine uptake system ATP-binding protein YehX Escherichia coli (strain K12)
Q7A7E3 5.04e-25 103 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 5.04e-25 103 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q609Q1 5.45e-25 103 32 5 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q46Y69 5.48e-25 103 32 5 223 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q12NL5 5.65e-25 101 32 6 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q81GU1 5.74e-25 103 30 4 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P36947 5.81e-25 105 30 2 216 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
P36947 1.74e-16 81 29 4 206 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q0SFY5 5.98e-25 103 31 6 230 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
P0DTT6 6.1e-25 101 26 4 240 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q7N2D9 6.37e-25 105 28 3 214 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N2D9 8.72e-19 87 27 3 220 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3M5J9 6.68e-25 101 32 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q92W56 6.73e-25 105 34 5 223 3 araG Arabinose import ATP-binding protein AraG Rhizobium meliloti (strain 1021)
Q92W56 2.34e-15 77 29 5 206 3 araG Arabinose import ATP-binding protein AraG Rhizobium meliloti (strain 1021)
Q55EH8 6.76e-25 105 29 7 220 3 abcG23 ABC transporter G family member 23 Dictyostelium discoideum
Q9A502 7.53e-25 103 33 5 217 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9JUX4 7.57e-25 103 29 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q03ZQ0 7.64e-25 103 28 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P57066 7.88e-25 100 32 6 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1R528 9.07e-25 105 31 4 216 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q1R528 6.98e-16 79 28 5 210 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q65VG9 9.48e-25 103 28 6 246 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1TAI4 9.57e-25 103 31 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q62K82 9.59e-25 103 32 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q9CL63 9.68e-25 105 31 3 218 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
Q9CL63 6.86e-15 76 28 3 217 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
P74548 9.72e-25 103 30 6 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q63TY1 9.89e-25 103 32 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q9Z3I3 9.91e-25 102 31 3 222 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q5XCA4 9.95e-25 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7WGW1 9.99e-25 103 31 6 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W9U5 1.01e-24 103 31 6 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q65HB9 1.01e-24 101 29 8 248 3 pstB2 Phosphate import ATP-binding protein PstB 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q92V71 1.01e-24 101 29 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q664G2 1.01e-24 104 32 2 231 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 2.59e-17 83 30 5 210 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1MQ44 1.02e-24 103 33 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q9JZW0 1.03e-24 103 29 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5M4F2 1.04e-24 101 28 8 238 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZU2 1.04e-24 101 28 8 238 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain CNRZ 1066)
Q1CDJ0 1.05e-24 104 32 2 231 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 2.59e-17 83 30 5 210 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 1.05e-24 104 32 2 231 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 2.59e-17 83 30 5 210 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 1.05e-24 104 32 2 231 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 2.59e-17 83 30 5 210 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q31V51 1.07e-24 104 31 4 216 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q31V51 9.83e-16 79 26 5 214 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q8XDM1 1.07e-24 104 31 4 216 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8XDM1 9.83e-16 79 26 5 214 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q1MLW4 1.08e-24 101 30 6 233 3 pstB1 Phosphate import ATP-binding protein PstB 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8FCE2 1.09e-24 104 31 4 216 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCE2 3.08e-16 80 28 5 210 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBN5 1.09e-24 104 31 4 216 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBN5 3.08e-16 80 28 5 210 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9MUN1 1.12e-24 102 30 4 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
P0CZ35 1.12e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 1.12e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 1.12e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q2YVT7 1.16e-24 102 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7N6Z2 1.2e-24 103 30 4 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q14Q07 1.29e-24 102 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q8U6M1 1.3e-24 102 31 4 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9V1Q4 1.42e-24 101 32 7 233 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q1J6Q6 1.56e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 1.56e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 1.56e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 1.56e-24 103 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7MNI7 1.57e-24 101 30 7 220 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 1.57e-24 101 30 7 220 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
Q5WET8 1.64e-24 100 30 8 226 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
Q0BH79 1.7e-24 102 31 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q12XW6 1.7e-24 100 30 6 222 3 pstB Phosphate import ATP-binding protein PstB Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8PC11 1.71e-24 102 33 7 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q663Y5 1.79e-24 103 28 5 249 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q663Y5 1.15e-15 79 27 5 226 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDC0 1.79e-24 103 28 5 249 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDC0 1.15e-15 79 27 5 226 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFR2 1.79e-24 103 28 5 249 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q7CFR2 1.15e-15 79 27 5 226 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q1C0D5 1.79e-24 103 28 5 249 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C0D5 1.15e-15 79 27 5 226 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ELA5 1.92e-24 102 30 5 238 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9K8N1 1.94e-24 100 31 6 227 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3AAA4 1.95e-24 100 30 7 236 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9X196 2.01e-24 102 30 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8DQH4 2.04e-24 99 28 4 221 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 2.04e-24 99 28 4 221 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q65F80 2.04e-24 102 30 5 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1LQF6 2.04e-24 102 32 5 221 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2KDV1 2.11e-24 100 29 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q92SA1 2.13e-24 100 30 6 233 3 pstB Phosphate import ATP-binding protein PstB Rhizobium meliloti (strain 1021)
Q7CN92 2.31e-24 102 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 2.31e-24 102 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q987E7 2.35e-24 103 29 2 219 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q987E7 1.98e-14 75 27 5 228 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8XBJ8 2.35e-24 102 28 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q8FFB3 2.4e-24 102 28 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7VZ66 2.44e-24 100 33 8 213 3 pstB Phosphate import ATP-binding protein PstB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W8Q6 2.58e-24 100 33 8 213 3 pstB Phosphate import ATP-binding protein PstB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMC3 2.58e-24 100 33 8 213 3 pstB Phosphate import ATP-binding protein PstB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P16676 2.58e-24 102 28 4 233 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q9CP06 2.63e-24 102 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q6HG98 2.66e-24 103 33 8 233 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 1.84e-15 78 30 6 230 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q98K23 2.82e-24 102 31 6 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6HDP8 2.95e-24 100 30 8 228 3 pstB Phosphate import ATP-binding protein PstB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634R8 2.95e-24 100 30 8 228 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ZK / E33L)
Q730R7 2.95e-24 100 30 8 228 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81LW6 2.95e-24 100 30 8 228 3 pstB Phosphate import ATP-binding protein PstB Bacillus anthracis
Q3IM24 3.1e-24 100 30 5 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q0K998 3.24e-24 102 32 7 241 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8R9I2 3.27e-24 99 31 5 222 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8E8K8 3.74e-24 101 29 4 217 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2SY12 3.85e-24 101 31 5 223 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0KDG3 3.93e-24 101 31 6 231 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9CM80 3.95e-24 101 30 4 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q2KCV5 4.16e-24 100 29 6 232 3 pstB Phosphate import ATP-binding protein PstB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8DPC2 4.38e-24 102 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 4.38e-24 102 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 4.38e-24 102 30 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q92UV5 4.5e-24 102 32 4 200 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q5HQ70 4.56e-24 101 28 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9CNJ7 4.67e-24 99 31 7 212 3 pstB Phosphate import ATP-binding protein PstB Pasteurella multocida (strain Pm70)
P37388 4.7e-24 102 30 4 216 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
P37388 1.11e-15 79 26 5 214 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
Q9A7X1 4.83e-24 101 30 5 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7VZE5 5.08e-24 101 31 6 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q4JTG9 5.24e-24 101 30 5 224 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q83HT1 5.25e-24 99 30 5 222 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain TW08/27)
O34677 5.31e-24 99 29 3 217 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q1BY14 5.51e-24 100 31 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 5.51e-24 100 31 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q9KRT4 5.73e-24 101 31 5 215 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O67154 5.77e-24 99 30 6 221 3 pstB Phosphate import ATP-binding protein PstB Aquifex aeolicus (strain VF5)
Q5E3B8 5.92e-24 99 29 7 226 3 pstB2 Phosphate import ATP-binding protein PstB 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VNG4 6.01e-24 101 29 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q720M2 6.22e-24 99 30 8 239 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q3KBH4 6.46e-24 101 32 7 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q8YA75 6.48e-24 100 30 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q329G7 6.61e-24 102 31 2 231 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q329G7 5.18e-16 79 29 4 215 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q88AS5 6.91e-24 100 31 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q50966 7.29e-24 100 35 5 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q8UA73 7.41e-24 100 31 4 219 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2KVN7 7.48e-24 99 32 8 213 3 pstB Phosphate import ATP-binding protein PstB Bordetella avium (strain 197N)
Q81N53 8.06e-24 102 33 8 233 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q81N53 5.26e-15 77 30 6 230 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
E9Q876 8.17e-24 102 33 6 232 1 Abca12 Glucosylceramide transporter ABCA12 Mus musculus
E9Q876 4.32e-12 68 28 5 204 1 Abca12 Glucosylceramide transporter ABCA12 Mus musculus
Q74KF9 8.37e-24 99 31 7 224 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
P63354 8.56e-24 100 29 5 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 8.56e-24 100 29 5 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q724C0 8.91e-24 100 30 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q7MLB8 9.04e-24 100 32 4 200 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain YJ016)
Q7UC29 9.12e-24 100 27 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q8D954 9.14e-24 100 32 4 200 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain CMCP6)
P14788 9.19e-24 100 30 4 213 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1I4Q5 9.36e-24 98 27 3 236 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q02ME3 9.37e-24 100 31 5 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8ELR4 9.39e-24 100 30 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q830W6 9.42e-24 100 30 7 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FA19 9.51e-24 100 37 7 218 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q39IE7 9.57e-24 100 30 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6WB51 1e-23 99 31 7 227 3 pstB Phosphate import ATP-binding protein PstB Alcaligenes faecalis
Q6MU19 1.03e-23 100 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q82WT5 1.11e-23 100 30 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q92VJ2 1.14e-23 100 33 7 215 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q1B677 1.15e-23 100 31 4 217 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q9HMZ4 1.22e-23 97 32 5 220 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q92EZ6 1.26e-23 100 30 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q73P71 1.28e-23 98 31 7 235 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8ZPK4 1.29e-23 100 32 8 240 1 osmV Osmoprotectant import ATP-binding protein OsmV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83GE8 1.35e-23 98 30 5 222 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
Q49WM4 1.37e-23 100 28 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1GMA8 1.45e-23 98 29 6 237 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q2SSS4 1.46e-23 100 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q818I7 1.47e-23 98 30 8 228 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5E4V6 1.51e-23 101 30 6 228 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 1.1e-20 93 30 4 206 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q832Y6 1.53e-23 100 30 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q5WC31 1.61e-23 101 29 2 220 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5WC31 4.13e-15 77 28 6 225 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5YZY9 1.69e-23 99 31 5 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
P46341 1.74e-23 98 32 7 226 3 pstB2 Phosphate import ATP-binding protein PstB 2 Bacillus subtilis (strain 168)
Q8UI76 1.77e-23 98 31 6 233 3 pstB Phosphate import ATP-binding protein PstB Agrobacterium fabrum (strain C58 / ATCC 33970)
P31134 1.81e-23 100 30 4 215 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q8N139 1.82e-23 102 30 4 217 1 ABCA6 ATP-binding cassette sub-family A member 6 Homo sapiens
Q8N139 6.77e-12 68 25 4 199 1 ABCA6 ATP-binding cassette sub-family A member 6 Homo sapiens
O34814 1.83e-23 97 25 4 221 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
Q5LX21 1.96e-23 99 32 5 216 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5M4F3 1.98e-23 98 27 7 247 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZU3 1.98e-23 98 27 7 247 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus thermophilus (strain CNRZ 1066)
Q5XBY7 1.99e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8E9I8 2.04e-23 97 30 5 223 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q1WVI7 2.05e-23 99 28 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q2K4V4 2.05e-23 99 31 4 213 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q48TC3 2.05e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D2 2.05e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGL3 2.05e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q18AM3 2.08e-23 99 31 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q1JLH7 2.1e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBJ5 2.1e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q3K6R9 2.23e-23 97 30 5 241 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
P0CZ37 2.31e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P63377 2.31e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0CZ36 2.31e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63375 2.31e-23 97 32 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M1
Q81GC1 2.31e-23 99 32 6 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q4K681 2.47e-23 99 33 4 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9I6T2 2.51e-23 99 33 4 203 3 potA1 Spermidine/putrescine import ATP-binding protein PotA 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KHT9 2.57e-23 100 30 4 229 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 2.57e-23 100 30 4 229 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q89UD2 2.58e-23 99 29 5 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8Y7R4 2.6e-23 97 30 7 223 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8CPN0 2.65e-23 99 28 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5L222 2.7e-23 99 32 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q7NIW1 2.83e-23 99 29 5 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9YGA6 2.96e-23 99 29 6 235 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q47Y12 3.07e-23 97 30 7 225 3 pstB Phosphate import ATP-binding protein PstB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8DZJ0 3.08e-23 99 29 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 3.08e-23 99 29 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 3.08e-23 99 29 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q04B25 3.19e-23 99 29 6 227 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q2PBM3 3.21e-23 100 27 3 229 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
Q2PBM3 2.96e-18 86 27 3 219 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
Q9V2C0 3.26e-23 99 31 5 215 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q1M360 3.38e-23 100 32 7 226 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M360 5.53e-15 77 26 4 217 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MCN6 3.44e-23 99 31 4 213 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8NQU4 3.46e-23 97 28 2 236 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q1GAN9 3.46e-23 99 29 6 227 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P45171 3.48e-23 99 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3A558 3.59e-23 96 30 6 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q46ZM0 3.65e-23 99 31 7 239 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8GDV4 3.73e-23 97 30 8 240 3 pstB Phosphate import ATP-binding protein PstB (Fragment) Heliobacterium mobile
Q6D1C4 3.79e-23 98 30 6 229 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q97JB8 3.9e-23 97 27 7 233 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8DIA0 3.9e-23 98 31 4 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2K204 4.15e-23 100 30 7 244 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K204 3.08e-10 62 28 5 210 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q4QK57 4.18e-23 99 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
A3PRY1 4.18e-23 98 33 4 211 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q7AH43 4.34e-23 98 27 5 237 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q5KVK2 4.68e-23 98 31 5 219 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
P9WQM1 4.99e-23 98 31 5 229 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 4.99e-23 98 31 5 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 4.99e-23 98 31 5 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8PNN4 5.1e-23 98 33 6 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q1QYT1 5.12e-23 100 29 3 237 3 araG Arabinose import ATP-binding protein AraG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QYT1 1.37e-15 78 27 4 204 3 araG Arabinose import ATP-binding protein AraG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
O59479 5.68e-23 97 31 9 235 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q82TL6 5.7e-23 98 32 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9CEW7 5.77e-23 97 30 8 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9K876 5.95e-23 98 30 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O32169 6.15e-23 98 30 5 223 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q8XED0 6.17e-23 100 28 5 221 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q65S66 6.18e-23 98 29 4 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8PY27 6.58e-23 97 31 7 234 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P9WQL9 6.8e-23 97 33 4 202 1 drrA Doxorubicin resistance ATP-binding protein DrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL8 6.8e-23 97 33 4 202 3 drrA Doxorubicin resistance ATP-binding protein DrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5JEB0 6.99e-23 97 32 5 215 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9HNI8 7.09e-23 97 31 4 219 3 phnC Phosphonates import ATP-binding protein PhnC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q57T09 7.36e-23 97 29 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q8CUY0 7.41e-23 96 28 7 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8FV85 7.57e-23 98 30 4 228 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 7.57e-23 98 30 4 228 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 7.57e-23 98 30 4 228 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 7.57e-23 98 30 4 228 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q83LR7 7.62e-23 99 29 5 221 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q74AT2 7.71e-23 95 31 6 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8YNJ3 7.9e-23 96 30 6 213 3 pstB3 Phosphate import ATP-binding protein PstB 3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8UII7 7.94e-23 98 29 7 234 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3MA91 8.15e-23 96 30 6 212 3 pstB3 Phosphate import ATP-binding protein PstB 3 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8RGC8 8.31e-23 98 28 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8ZRM9 8.32e-23 97 29 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XZ72 8.34e-23 96 32 8 213 3 pstB Phosphate import ATP-binding protein PstB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q30V33 8.49e-23 98 29 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8RQL7 8.53e-23 95 27 5 241 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q5HV18 8.57e-23 97 27 4 233 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 8.57e-23 97 27 4 233 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q7N9U4 8.78e-23 96 31 9 229 3 pstB Phosphate import ATP-binding protein PstB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9TKX3 9.11e-23 97 30 5 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q92CK1 9.14e-23 96 30 8 239 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q88YK7 9.27e-23 95 32 8 234 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9Z3R9 9.28e-23 97 31 6 217 3 aglK Alpha-glucoside transport ATP-binding protein AglK Rhizobium meliloti (strain 1021)
Q6ADG4 9.33e-23 96 30 5 214 3 pstB Phosphate import ATP-binding protein PstB Leifsonia xyli subsp. xyli (strain CTCB07)
Q9CEW8 9.34e-23 95 28 8 248 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q9I1C8 9.55e-23 98 30 5 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q92WD6 9.63e-23 97 32 6 227 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhizobium meliloti (strain 1021)
Q65QT6 9.78e-23 98 31 5 209 3 malK Maltose/maltodextrin import ATP-binding protein MalK Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65HC0 9.83e-23 96 30 7 212 3 pstB1 Phosphate import ATP-binding protein PstB 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q45460 9.92e-23 98 31 4 229 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
A3CMQ7 1.02e-22 98 32 9 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q82VK1 1.03e-22 99 27 5 224 3 macB Macrolide export ATP-binding/permease protein MacB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P61482 1.05e-22 95 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 1.05e-22 95 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 1.05e-22 95 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5WCI1 1.05e-22 95 33 5 214 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Shouchella clausii (strain KSM-K16)
P37009 1.05e-22 97 27 5 237 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q8WWZ4 1.06e-22 99 30 5 220 2 ABCA10 ATP-binding cassette sub-family A member 10 Homo sapiens
Q8WWZ4 1.63e-11 67 25 4 199 2 ABCA10 ATP-binding cassette sub-family A member 10 Homo sapiens
Q2YUY7 1.14e-22 95 29 5 231 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9PBK0 1.15e-22 96 32 8 229 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain 9a5c)
P48243 1.18e-22 95 27 4 222 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q31BF6 1.22e-22 95 29 6 215 3 pstB Phosphate import ATP-binding protein PstB Prochlorococcus marinus (strain MIT 9312)
Q0BTP1 1.23e-22 96 31 6 230 3 pstB Phosphate import ATP-binding protein PstB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8Z0H0 1.23e-22 97 30 4 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q65WJ1 1.26e-22 99 27 2 240 3 araG Arabinose import ATP-binding protein AraG Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65WJ1 1.23e-13 72 28 4 203 3 araG Arabinose import ATP-binding protein AraG Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9PDN2 1.27e-22 97 31 7 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
P44531 1.28e-22 97 29 5 217 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9WYI7 1.3e-22 95 32 5 207 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9RYZ3 1.32e-22 95 32 6 214 3 pstB Phosphate import ATP-binding protein PstB Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8YM92 1.36e-22 97 28 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8CQS7 1.36e-22 97 28 5 221 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 1.36e-22 97 28 5 221 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8Y0X3 1.42e-22 97 31 5 222 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q65E55 1.43e-22 98 29 2 216 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q65E55 5.06e-16 79 29 4 210 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q88CL2 1.45e-22 97 30 6 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8XZX8 1.52e-22 97 31 8 240 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0ASQ1 1.54e-22 95 30 6 238 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q9AML4 1.55e-22 95 31 9 231 3 pstB Phosphate import ATP-binding protein PstB Edwardsiella tarda
Q5FM17 1.56e-22 95 29 7 242 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5PID0 1.56e-22 97 29 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P55662 1.59e-22 95 29 5 233 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q3IX40 1.6e-22 97 32 4 211 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q57QD7 1.61e-22 95 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q9CP98 1.61e-22 98 29 4 224 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 1.47e-21 95 27 2 219 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q8Z4V6 1.64e-22 97 27 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q15TB1 1.7e-22 94 31 5 220 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5JEP9 1.75e-22 95 29 5 213 3 pstB Phosphate import ATP-binding protein PstB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P40860 1.78e-22 97 27 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O34979 1.79e-22 94 30 7 229 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q2L0H5 1.83e-22 97 30 7 239 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella avium (strain 197N)
A1KF14 1.83e-22 99 36 9 221 1 BCG_0231 Multidrug efflux ATP-binding/permease protein BCG_0231 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
A1KF14 6.09e-08 56 29 11 223 1 BCG_0231 Multidrug efflux ATP-binding/permease protein BCG_0231 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q8UFV7 1.88e-22 94 32 7 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Agrobacterium fabrum (strain C58 / ATCC 33970)
Q325U1 1.92e-22 97 29 5 225 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
P30750 1.94e-22 96 29 5 225 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q5SLN1 1.95e-22 95 30 9 249 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
O53645 1.96e-22 99 36 9 221 1 Rv0194 Multidrug efflux ATP-binding/permease protein Rv0194 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O53645 6.68e-08 56 29 11 223 1 Rv0194 Multidrug efflux ATP-binding/permease protein Rv0194 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q93DX8 1.97e-22 95 31 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q86UK0 1.99e-22 99 32 7 234 1 ABCA12 Glucosylceramide transporter ABCA12 Homo sapiens
Q86UK0 5.51e-12 68 28 6 207 1 ABCA12 Glucosylceramide transporter ABCA12 Homo sapiens
B1LFA2 2e-22 98 28 3 230 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
B1LFA2 1.2e-17 84 28 3 226 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
Q0TLD2 2e-22 96 29 5 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32EX7 2e-22 94 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q734T1 2.05e-22 98 33 7 233 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q734T1 6.18e-15 76 30 5 226 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0K9I2 2.07e-22 96 31 4 219 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3Z5F8 2.08e-22 96 29 5 225 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 2.08e-22 96 29 5 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 2.08e-22 96 29 5 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 2.08e-22 96 29 5 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q4L5B3 2.09e-22 97 28 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q6D664 2.13e-22 94 33 7 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0AU85 2.18e-22 96 30 5 221 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q73XU8 2.22e-22 97 31 5 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q88J90 2.23e-22 98 31 1 219 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88J90 8.27e-17 82 30 4 210 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7N8B9 2.25e-22 96 29 4 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6LH11 2.25e-22 98 30 6 228 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 1.01e-19 90 28 3 206 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q1LJ08 2.27e-22 95 32 6 232 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P47650 2.3e-22 96 27 8 249 3 pstB Phosphate import ATP-binding protein PstB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q1AS06 2.36e-22 97 30 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q46YX6 2.39e-22 96 30 6 237 3 nodI Nod factor export ATP-binding protein I Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q21XJ9 2.4e-22 95 30 4 217 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8Z1U0 2.42e-22 97 29 6 214 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhi
Q73YZ5 2.47e-22 94 32 6 228 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07400
Feature type CDS
Gene livF
Product high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF
Location 148538 - 149239 (strand: 1)
Length 702 (nucleotides) / 233 (amino acids)
In genomic island -

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2630
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0410 Amino acid transport and metabolism (E) E ABC-type branched-chain amino acid transport system, ATPase component LivF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01996 branched-chain amino acid transport system ATP-binding protein ABC transporters
Quorum sensing
-

Protein Sequence

MLEFNNVSAQYGKIQALHEVSLSVRKGEIVTLIGANGAGKTTLLSTLCGEPRATTGEIRYLGENITALPTAQIMRKDIALVPEGRRVFGRMTVEENLAMGGFFASKTQYQARIAQVYELFPRLQERRHQRAGTMSGGEQQMLAIGRALMSSPQLLLLDEPSLGLAPIIIMQIFDTIRELRDAGMTIFLVEQNANQALKLADRGYVLENGRVVLEDTGQALLVNEAVRSAYLGG

Flanking regions ( +/- flanking 50bp)

ATCCGCAACCACCCGGACGTGATCCGCGCGTATTTGGGGGAGGCATACTGATGCTGGAATTTAATAATGTCTCCGCGCAGTACGGCAAAATTCAGGCGCTGCATGAAGTCAGCCTGTCGGTGCGTAAAGGGGAAATAGTCACCCTGATCGGCGCGAACGGTGCGGGGAAAACCACGCTGCTCAGCACGCTGTGCGGGGAGCCGCGGGCGACCACCGGCGAGATCCGCTACCTCGGGGAGAATATCACGGCACTGCCGACGGCGCAGATCATGCGCAAAGACATTGCACTGGTGCCGGAAGGGCGGCGCGTGTTCGGGCGGATGACGGTGGAAGAGAATCTGGCCATGGGCGGATTTTTTGCATCCAAAACGCAGTATCAGGCACGGATTGCTCAGGTATATGAGCTTTTCCCGAGGCTTCAGGAGCGCCGCCATCAGCGGGCGGGAACAATGTCCGGCGGTGAACAGCAGATGCTGGCTATCGGCCGTGCGCTGATGAGCAGTCCTCAGTTGTTACTGCTGGATGAACCGTCCCTCGGGCTGGCGCCGATTATCATCATGCAGATTTTCGATACCATCCGTGAACTGCGTGATGCGGGTATGACTATCTTCCTGGTCGAACAGAATGCCAACCAGGCGCTGAAACTGGCAGACAGAGGTTATGTGCTTGAAAACGGGCGGGTCGTACTGGAGGATACCGGTCAGGCACTGCTGGTGAATGAAGCGGTCAGGAGTGCCTATCTGGGTGGCTGATCGGATGATGGTTTTCCGGAAAAAATCTGACGGAATTTGTCCTCATTTTC