Homologs in group_413

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17920 FBDBKF_17920 100.0 Morganella morganii S1 alpA DNA-binding transcriptional regulator AlpA
EHELCC_06415 EHELCC_06415 100.0 Morganella morganii S2 alpA DNA-binding transcriptional regulator AlpA
LHKJJB_19335 LHKJJB_19335 100.0 Morganella morganii S3 alpA DNA-binding transcriptional regulator AlpA
HKOGLL_04655 HKOGLL_04655 100.0 Morganella morganii S5 alpA DNA-binding transcriptional regulator AlpA
F4V73_RS02460 F4V73_RS02460 50.8 Morganella psychrotolerans - AlpA family transcriptional regulator
F4V73_RS10120 F4V73_RS10120 50.8 Morganella psychrotolerans - AlpA family transcriptional regulator
PMI_RS12875 PMI_RS12875 100.0 Proteus mirabilis HI4320 - AlpA family transcriptional regulator

Distribution of the homologs in the orthogroup group_413

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_413

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 1.17e-07 47 37 1 62 4 None Uncharacterized protein ORF88 Enterobacteria phage P4
P33997 2.17e-06 43 36 2 61 4 alpA DNA-binding transcriptional activator AlpA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06735
Feature type CDS
Gene alpA
Product DNA-binding transcriptional regulator AlpA
Location 12083 - 12271 (strand: -1)
Length 189 (nucleotides) / 62 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_413
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF05930 Prophage CP4-57 regulatory protein (AlpA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MTSHQLLRLKQVEEKTGLKRSQIYLYMKGGSFPRSIIKVGPASVAWLESEIDEWINLKLANR

Flanking regions ( +/- flanking 50bp)

CGCTTATGCTTTTTTATCTTCTCCAACCCCACTCTACACTGGAGAAAATCATGACATCACATCAGTTATTACGCCTGAAACAGGTCGAAGAAAAAACCGGTCTGAAACGCTCGCAAATCTATCTGTATATGAAAGGGGGCTCTTTTCCTCGTTCAATAATAAAGGTTGGCCCTGCCAGCGTAGCCTGGCTCGAATCTGAAATTGATGAATGGATCAACCTCAAATTAGCCAACCGCTGAAGTGTTTAAGGAAGGTCCGAAATCATGATTCCGTCTCTGAATTACGCCGT