Homologs in group_151

Help

9 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04630 FBDBKF_04630 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_05920 EHELCC_05920 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_03120 LHKJJB_03120 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_06595 HKOGLL_06595 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS01640 F4V73_RS01640 38.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS02265 F4V73_RS02265 33.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS08420 F4V73_RS08420 30.6 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS09080 F4V73_RS09080 90.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS10915 F4V73_RS10915 29.2 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_151

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_151

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 3.1e-13 62 42 0 61 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 3.1e-13 62 42 0 61 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P15017 3.6e-10 54 43 0 60 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q92HV3 8.39e-09 51 38 0 67 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 9.29e-09 51 38 0 67 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
P55681 2.94e-08 50 31 0 66 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P16117 5.51e-06 43 34 1 61 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
Q8TZX4 2.43e-05 43 36 0 55 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P55360 0.000236 40 34 0 61 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O59472 0.000249 40 34 0 55 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O31943 0.000531 38 32 0 59 4 yonR SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YonR Bacillus subtilis (strain 168)
O34647 0.000881 37 31 0 57 4 yobD Uncharacterized HTH-type transcriptional regulator YobD Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06240
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 226183 - 226401 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_151
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

METESIYSCVGTRIKEKRKYLGLSVVRLAEDMGITQQQFNRYERGTSRISIHYLMYLAEMFHVPVDYFFDQE

Flanking regions ( +/- flanking 50bp)

AAACGGAATTTTTTGTTATCACGTTGTCAATATAAGTGAAGGAGAATCTTATGGAGACGGAATCTATATATTCCTGTGTCGGAACACGGATTAAAGAAAAGCGAAAATACTTAGGATTAAGTGTCGTCCGGTTAGCGGAAGATATGGGAATAACGCAGCAGCAATTTAACCGTTATGAACGGGGAACAAGCCGGATTAGTATACATTATCTGATGTATCTGGCAGAAATGTTCCATGTTCCGGTGGATTACTTTTTCGATCAGGAATAGTTTATCCCCGCTAAGTAGTGACACCGTACCACCTGTATGTGAGAATAGCC