Homologs in group_122

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04495 FBDBKF_04495 54.8 Morganella morganii S1 galS HTH-type transcriptional regulator GalS
FBDBKF_11080 FBDBKF_11080 100.0 Morganella morganii S1 purR DNA-binding transcriptional regulator, LacI/PurR family
EHELCC_05145 EHELCC_05145 100.0 Morganella morganii S2 purR DNA-binding transcriptional regulator, LacI/PurR family
EHELCC_05785 EHELCC_05785 54.8 Morganella morganii S2 galS HTH-type transcriptional regulator GalS
NLDBIP_06105 NLDBIP_06105 54.8 Morganella morganii S4 galS HTH-type transcriptional regulator GalS
LHKJJB_02345 LHKJJB_02345 100.0 Morganella morganii S3 purR DNA-binding transcriptional regulator, LacI/PurR family
LHKJJB_02985 LHKJJB_02985 54.8 Morganella morganii S3 galS HTH-type transcriptional regulator GalS
HKOGLL_06460 HKOGLL_06460 54.8 Morganella morganii S5 galS HTH-type transcriptional regulator GalS
HKOGLL_15725 HKOGLL_15725 100.0 Morganella morganii S5 purR DNA-binding transcriptional regulator, LacI/PurR family
PMI_RS09595 PMI_RS09595 62.9 Proteus mirabilis HI4320 - substrate-binding domain-containing protein

Distribution of the homologs in the orthogroup group_122

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_122

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03024 1.39e-122 358 55 0 329 1 galR HTH-type transcriptional regulator GalR Escherichia coli (strain K12)
P25748 1.25e-121 356 54 0 332 1 galS HTH-type transcriptional regulator GalS Escherichia coli (strain K12)
P0CL11 2.19e-117 345 54 0 329 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAQ4 2.19e-117 345 54 0 329 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain SL1344)
P41030 5.35e-117 344 52 0 332 3 galS HTH-type transcriptional regulator GalS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31766 1.79e-113 335 51 2 334 4 galR HTH-type transcriptional regulator GalR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24242 2.28e-53 181 35 6 337 1 ascG HTH-type transcriptional regulator AscG Escherichia coli (strain K12)
P0ACP0 1.73e-52 179 36 2 294 3 cytR HTH-type transcriptional repressor CytR Shigella flexneri
P0ACN7 1.73e-52 179 36 2 294 1 cytR HTH-type transcriptional repressor CytR Escherichia coli (strain K12)
P0ACN8 1.73e-52 179 36 2 294 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACN9 1.73e-52 179 36 2 294 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O157:H7
Q7VL44 3.55e-51 176 32 1 331 3 purR HTH-type transcriptional repressor PurR Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1RBD7 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain UTI89 / UPEC)
Q0THG9 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABJ9 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O1:K1 / APEC
B7MVD4 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O81 (strain ED1a)
B7MA12 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URZ9 4.72e-51 175 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2VEM5 5.47e-51 175 34 3 339 3 purR HTH-type transcriptional repressor PurR Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8FH72 1.43e-50 174 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZMC4 2.28e-50 174 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O139:H28 (strain E24377A / ETEC)
P0ACP9 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella flexneri
Q0T4B4 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella flexneri serotype 5b (strain 8401)
Q321B7 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 4 (strain Sb227)
B2U2G3 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LEM6 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SMS-3-5 / SECEC)
B6IB98 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SE11)
B7NBB1 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACP7 2.43e-50 173 35 4 311 1 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12)
B1IQ96 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0K5 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O9:H4 (strain HS)
C4ZYC2 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0L5 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O8 (strain IAI1)
B7NTX5 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z492 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACP8 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7
B7L5L1 2.43e-50 173 35 4 311 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain 55989 / EAEC)
B7LQA9 2.97e-50 173 34 6 337 3 purR HTH-type transcriptional repressor PurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q9CN88 3.81e-50 173 32 3 338 3 purR HTH-type transcriptional repressor PurR Pasteurella multocida (strain Pm70)
A7N1L2 5.9e-50 172 33 4 334 3 purR HTH-type transcriptional repressor PurR Vibrio campbellii (strain ATCC BAA-1116)
Q3Z213 8.53e-50 172 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella sonnei (strain Ss046)
A9MEJ1 9.38e-50 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32FB3 9.58e-50 172 35 4 311 3 purR HTH-type transcriptional repressor PurR Shigella dysenteriae serotype 1 (strain Sd197)
O68446 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUY8 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella schwarzengrund (strain CVM19633)
C0Q5V2 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi C (strain RKS4594)
A9N0Y2 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TH70 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella heidelberg (strain SL476)
B5RAM9 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV29 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella enteritidis PT4 (strain P125109)
B5FIH3 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella dublin (strain CT_02021853)
Q57PK6 1.02e-49 172 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella choleraesuis (strain SC-B67)
B5XWL8 1.55e-49 171 35 4 311 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae (strain 342)
Q8Z6P1 2.63e-49 171 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella typhi
B4T567 2.63e-49 171 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella newport (strain SL254)
B5F6L7 2.63e-49 171 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella agona (strain SL483)
B5BKD9 2.66e-49 171 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain AKU_12601)
Q5PH15 2.66e-49 171 35 3 314 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0ACQ3 4.02e-49 170 34 5 332 3 rbsR Ribose operon repressor Shigella flexneri
P0ACQ0 4.02e-49 170 34 5 332 1 rbsR Ribose operon repressor Escherichia coli (strain K12)
P0ACQ1 4.02e-49 170 34 5 332 3 rbsR Ribose operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ2 4.02e-49 170 34 5 332 3 rbsR Ribose operon repressor Escherichia coli O157:H7
A6TA06 6.16e-49 170 34 4 311 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MFD3 7.62e-49 169 34 4 311 3 purR HTH-type transcriptional repressor PurR Cronobacter sakazakii (strain ATCC BAA-894)
Q7MJ57 9.88e-49 169 32 2 331 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain YJ016)
Q8DAQ5 9.88e-49 169 32 2 331 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain CMCP6)
P37947 1.2e-48 169 31 5 335 1 degA HTH-type transcriptional regulator DegA Bacillus subtilis (strain 168)
Q87QW9 1.39e-48 169 32 4 334 3 purR HTH-type transcriptional repressor PurR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6VNL0 2.14e-48 168 33 3 332 3 purR HTH-type transcriptional repressor PurR Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B7VMG4 3.22e-48 167 34 4 309 3 purR HTH-type transcriptional repressor PurR Vibrio atlanticus (strain LGP32)
Q9CPA2 5.47e-48 167 33 2 330 3 rbsR Ribose operon repressor Pasteurella multocida (strain Pm70)
Q0I4B4 1.27e-47 166 32 3 334 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 129Pt)
Q9JMQ1 1.81e-47 166 32 4 314 2 exuR Probable HTH-type transcriptional repressor ExuR Bacillus subtilis (strain 168)
C3LN44 2.49e-47 166 32 3 307 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain M66-2)
Q9KRC1 2.49e-47 166 32 3 307 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7H0 2.49e-47 166 32 3 307 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FF00 2.75e-47 165 31 3 338 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain MJ11)
Q65TP0 2.81e-47 165 32 3 332 3 purR HTH-type transcriptional repressor PurR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UUN7 3.25e-47 165 32 3 334 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 2336)
B0BP99 6.07e-47 164 30 1 331 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
C5BE45 5.36e-46 162 33 4 333 3 purR HTH-type transcriptional repressor PurR Edwardsiella ictaluri (strain 93-146)
Q45831 6.17e-46 162 29 5 337 4 regA HTH-type transcriptional regulator RegA Clostridium saccharobutylicum
Q5E4H9 1.28e-45 161 30 3 338 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain ATCC 700601 / ES114)
B3H1F6 1.77e-45 160 29 1 331 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0H9 1.77e-45 160 29 1 331 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B6EH86 2.14e-45 160 31 1 305 3 purR HTH-type transcriptional repressor PurR Aliivibrio salmonicida (strain LFI1238)
A1JP52 2.19e-45 160 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DK36 2.41e-45 160 32 3 339 3 purR HTH-type transcriptional repressor PurR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6LQB9 2.44e-45 160 30 2 331 3 purR HTH-type transcriptional repressor PurR Photobacterium profundum (strain SS9)
Q1C774 2.62e-45 160 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Antiqua)
B1JJ59 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66A32 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIQ4 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pestis (strain Pestoides F)
Q1CIL0 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZB3 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Angola)
Q7CIS2 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pestis
B2K5I4 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHK2 5.11e-45 159 33 4 333 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GDV6 6.05e-45 159 33 2 332 3 purR HTH-type transcriptional repressor PurR Serratia proteamaculans (strain 568)
Q6D5W3 1.22e-44 159 33 3 332 3 purR HTH-type transcriptional repressor PurR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O87590 1.63e-44 158 33 5 315 4 celR HTH-type transcriptional regulator CelR Thermobifida fusca
B8F4D0 2.59e-44 157 31 5 338 3 purR HTH-type transcriptional repressor PurR Glaesserella parasuis serovar 5 (strain SH0165)
B4EWM9 8.32e-44 156 32 2 307 3 purR HTH-type transcriptional repressor PurR Proteus mirabilis (strain HI4320)
P25144 9.37e-44 156 29 1 309 1 ccpA Catabolite control protein A Bacillus subtilis (strain 168)
A5UCM9 1.41e-43 155 29 1 334 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittEE)
Q4QL70 1.41e-43 155 29 1 334 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain 86-028NP)
Q9K6K2 3.91e-43 154 30 4 313 3 rbsR Ribose operon repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7N3V8 8.21e-43 154 33 3 307 3 purR HTH-type transcriptional repressor PurR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P44329 1.25e-42 153 30 3 334 3 rbsR Ribose operon repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UIZ0 2.76e-42 152 29 1 334 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittGG)
P46456 1.67e-41 150 29 1 334 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P46828 6.19e-41 149 28 2 303 1 ccpA Catabolite control protein A Priestia megaterium
P58258 1.79e-38 142 28 4 318 3 regA HTH-type transcriptional regulator RegA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O05103 2.2e-36 137 27 3 314 4 None HTH-type transcriptional regulator MalR Clostridium butyricum
P50844 4.52e-36 136 29 5 309 1 kdgR HTH-type transcriptional regulator KdgR Bacillus subtilis (strain 168)
P36944 1.38e-35 134 32 7 318 4 rbsR Ribose operon repressor Bacillus subtilis (strain 168)
Q8CNV8 1.6e-33 129 25 6 335 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNH3 1.6e-33 129 25 6 335 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q05954 1e-32 127 31 5 311 4 SCO4158 Uncharacterized HTH-type transcriptional regulator SCO4158 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A9KNI6 6.86e-32 125 27 6 318 2 Cphy_2742 HTH-type transcriptional regulator Cphy_2742 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
O07329 8.26e-32 124 28 9 335 3 ccpA Catabolite control protein A Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P43472 8.5e-32 124 30 5 291 3 scrR Sucrose operon repressor Pediococcus pentosaceus
Q9CF41 9.42e-32 124 27 5 316 3 rbsR Ribose operon repressor Lactococcus lactis subsp. lactis (strain IL1403)
Q54430 9.6e-31 121 27 6 314 4 scrR Sucrose operon repressor Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P27871 4.09e-30 120 25 5 311 4 endR Probable HTH-type transcriptional regulator EndR Paenibacillus polymyxa
Q56194 2.38e-29 118 24 7 333 3 ccpA Catabolite control protein A Staphylococcus xylosus
Q8NW33 4.35e-29 117 25 6 336 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MW2)
Q6G8J1 4.35e-29 117 25 6 336 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MSSA476)
P99175 4.35e-29 117 25 6 336 1 ccpA Catabolite control protein A Staphylococcus aureus (strain N315)
P67655 4.35e-29 117 25 6 336 3 ccpA Catabolite control protein A Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HF38 4.35e-29 117 25 6 336 3 ccpA Catabolite control protein A Staphylococcus aureus (strain COL)
Q6GFX2 1.58e-28 115 25 6 336 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MRSA252)
O07567 2.87e-28 115 27 5 301 4 ntdR NTD biosynthesis operon regulator NtdR Bacillus subtilis (strain 168)
P72396 7.75e-28 114 28 7 341 4 malR HTH-type transcriptional regulator MalR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P03023 9.45e-28 114 30 9 329 1 lacI Lactose operon repressor Escherichia coli (strain K12)
O06987 2.93e-27 112 28 10 337 4 yvdE Uncharacterized HTH-type transcriptional regulator YvdE Bacillus subtilis (strain 168)
Q9I1F6 4.47e-27 112 30 3 310 1 gntR HTH-type transcriptional regulator GntR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04939 6.94e-27 111 26 7 315 4 sacR Sucrose operon repressor Lactococcus lactis subsp. lactis
P72469 1.05e-26 111 28 8 342 4 reg1 HTH-type transcriptional regulator reg1 Streptomyces lividans
P0A4T2 4.08e-26 109 28 7 298 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4T1 4.08e-26 109 28 7 298 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P18811 8.24e-26 108 29 4 309 2 malI Maltose regulon regulatory protein MalI Escherichia coli (strain K12)
O31690 1.84e-25 107 27 5 300 4 ykvZ Uncharacterized HTH-type transcriptional regulator YkvZ Bacillus subtilis (strain 168)
Q48544 7.23e-25 105 25 4 338 4 pepR1 HTH-type transcriptional regulator pepR1 Lactobacillus delbrueckii subsp. lactis
P23823 2.25e-24 104 28 7 335 4 None Uncharacterized HTH-type transcriptional regulator in aml 5'region Streptomyces limosus
P21867 5.87e-22 97 30 9 287 1 rafR HTH-type transcriptional regulator RafR Escherichia coli
P0ACP5 6.18e-22 97 25 6 304 1 gntR HTH-type transcriptional regulator GntR Escherichia coli (strain K12)
P0ACP6 6.18e-22 97 25 6 304 3 gntR HTH-type transcriptional regulator GntR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9S470 1.29e-21 97 25 10 342 3 araR Arabinose metabolism transcriptional repressor Geobacillus stearothermophilus
P77615 1.78e-21 96 25 4 318 4 ycjW Uncharacterized HTH-type transcriptional regulator YcjW Escherichia coli (strain K12)
Q9KBQ0 2.27e-21 97 25 5 281 3 araR Arabinose metabolism transcriptional repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9Z3R4 9.78e-21 94 29 3 279 4 aglR HTH-type transcriptional regulator AglR Rhizobium meliloti (strain 1021)
P37517 2.15e-20 93 28 7 283 1 ccpB Catabolite control protein B Bacillus subtilis (strain 168)
Q88HH7 5.34e-20 92 30 3 194 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P96711 7.12e-20 92 23 10 340 1 araR Arabinose metabolism transcriptional repressor Bacillus subtilis (strain 168)
Q56201 7.58e-20 92 26 7 300 4 malR HTH-type transcriptional regulator MalR Staphylococcus xylosus
G3XD97 2.92e-19 90 24 6 341 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P06220 3.31e-19 90 24 7 329 4 lacI Lactose operon repressor (Fragment) Klebsiella pneumoniae
P62572 4.34e-19 89 28 10 316 3 cscR Sucrose operon repressor Shigella flexneri
P62604 4.34e-19 89 28 10 316 3 cscR Sucrose operon repressor Escherichia coli
P39343 1.55e-18 88 26 6 309 4 idnR HTH-type transcriptional regulator IdnR Escherichia coli (strain K12)
A0A167V873 6.24e-18 86 24 4 323 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas plecoglossicida
Q9ZB11 4.03e-17 84 24 12 356 3 galR HTH-type transcriptional regulator GalR Streptococcus thermophilus
O34829 9.63e-17 83 25 13 347 1 melR HTH-type transcriptional repressor MelR Bacillus subtilis (strain 168)
O84905 3.51e-13 72 25 9 318 3 galR HTH-type transcriptional regulator GalR Lacticaseibacillus casei
O07008 4.41e-13 72 25 10 319 1 ganR HTH-type transcriptional regulator GanR Bacillus subtilis (strain 168)
P36674 4.98e-12 69 23 5 286 3 treR HTH-type transcriptional regulator TreR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I2F8 6.07e-12 68 28 11 244 1 rbsB D-ribose/D-allose-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P96158 7.13e-12 65 38 0 100 4 malI Maltose regulon regulatory protein MalI (Fragment) Vibrio furnissii
P37076 8.24e-12 68 24 6 330 4 scrR Sucrose operon repressor Klebsiella pneumoniae
P06846 2.3e-11 67 26 12 336 4 ebgR HTH-type transcriptional regulator EbgR Escherichia coli (strain K12)
P36673 2.32e-10 64 22 5 286 1 treR HTH-type transcriptional regulator TreR Escherichia coli (strain K12)
P27872 4.19e-09 58 30 3 152 4 opnR Probable opine utilization operon repressor (Fragment) Rhizobium rhizogenes
Q01936 4.72e-09 57 35 0 81 4 lacI Lactose operon repressor (Fragment) Rhizobium radiobacter
Q9KM69 5.02e-09 60 25 9 296 1 fruR Fructose operon regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0ACP4 6.2e-09 60 29 1 121 3 cra Catabolite repressor/activator Shigella flexneri
P0ACP1 6.2e-09 60 29 1 121 1 cra Catabolite repressor/activator Escherichia coli (strain K12)
P0ACP2 6.2e-09 60 29 1 121 3 cra Catabolite repressor/activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACP3 6.2e-09 60 29 1 121 3 cra Catabolite repressor/activator Escherichia coli O157:H7
P37077 6.26e-09 60 22 7 338 4 scrR Sucrose operon repressor Salmonella typhimurium
P0A2P8 6.31e-09 60 29 1 121 3 cra Catabolite repressor/activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P9 6.31e-09 60 29 1 121 3 cra Catabolite repressor/activator Salmonella typhi
P74892 1.5e-07 55 24 11 301 4 scrR Sucrose operon repressor Staphylococcus xylosus
P24508 3.93e-07 50 33 1 111 4 scrR Sucrose operon repressor Vibrio alginolyticus
P36949 6.23e-07 53 26 5 218 1 rbsB Ribose import binding protein RbsB Bacillus subtilis (strain 168)
Q8NMF0 7.1e-07 53 25 12 340 1 ipsA HTH-type transcriptional regulator IpsA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P07760 1.13e-06 52 25 4 181 4 rbtR Ribitol operon repressor Klebsiella aerogenes
P02925 0.000207 46 25 8 249 1 rbsB Ribose import binding protein RbsB Escherichia coli (strain K12)
P23822 0.000365 42 36 0 63 4 None Uncharacterized HTH-type transcriptional regulator in aml 5'region (Fragment) Streptomyces violaceus
P0A2C5 0.000808 44 24 8 249 1 rbsB Ribose import binding protein RbsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2C6 0.000808 44 24 8 249 3 rbsB Ribose import binding protein RbsB Salmonella typhi

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05465
Feature type CDS
Gene purR
Product DNA-binding transcriptional regulator, LacI/PurR family
Location 60189 - 61193 (strand: -1)
Length 1005 (nucleotides) / 334 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_122
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00356 Bacterial regulatory proteins, lacI family
PF13377 Periplasmic binding protein-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1609 Transcription (K) K DNA-binding transcriptional regulator, LacI/PurR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02529 LacI family transcriptional regulator, galactose operon repressor - -

Protein Sequence

MATIKDVAKLAGVSVATVSRVINQSPKAGAESIRAVQAAMKELAYRPNAAARALVSQSSDIVGVLVGDVSDPFFGSLVKAADEVAHQHGKHLLIGNGYHRQEDERRGIELLMNSRCDACVIHAKALSDEELRGYAAEMPSMVFINRMIPGLENRCVALDNRRGTQLATQYLLKQGHRHIACLSSSHTIEDSAQRLAGYRDALTEAGCELPEAYIAVGEPVAEGGEAAMSAVLSLSLPVTAVVAYNDFMAAGALSVIEANGLRAPEDISVIGFDDSMIARYIQPRLTTIRYPVDMMAQTATQLALALASSQALPFCPPCYTPTLVLRHSVMSRFS

Flanking regions ( +/- flanking 50bp)

TTACACCGGATGGCAAGTACCGGGATCACAAAACAATAACGGAGCGGTAAATGGCAACCATTAAAGATGTTGCGAAACTGGCGGGGGTATCAGTGGCAACGGTCTCGCGGGTTATCAATCAGTCACCAAAAGCGGGGGCGGAATCCATCCGTGCGGTTCAGGCGGCCATGAAGGAGCTGGCTTACCGCCCGAATGCGGCGGCGCGGGCGCTGGTCAGCCAGAGCAGTGATATTGTCGGCGTGCTGGTGGGGGATGTGTCCGATCCGTTTTTCGGTTCACTGGTCAAAGCCGCAGATGAGGTGGCGCATCAGCACGGAAAACATCTTTTAATCGGCAACGGTTATCACCGGCAGGAAGATGAGCGGCGTGGTATTGAATTACTGATGAACAGCCGCTGTGATGCCTGCGTGATCCATGCCAAAGCACTGAGTGATGAAGAACTGCGCGGCTATGCAGCGGAGATGCCGTCGATGGTATTTATCAACCGTATGATCCCGGGGCTGGAAAACCGCTGTGTTGCTCTGGATAACCGGCGCGGGACTCAGCTTGCCACACAATATCTGCTGAAACAGGGGCACCGCCATATTGCCTGCTTATCGTCATCACACACGATTGAAGACAGCGCTCAGAGGCTGGCGGGCTACAGAGACGCTCTGACAGAAGCCGGTTGTGAGCTTCCTGAGGCCTATATTGCCGTTGGTGAACCGGTGGCAGAAGGCGGGGAAGCGGCAATGAGCGCTGTTTTGTCCCTTTCACTGCCGGTGACGGCGGTCGTGGCATACAACGATTTTATGGCGGCGGGGGCGCTGTCGGTGATTGAAGCGAACGGGCTGCGCGCGCCGGAAGATATTTCTGTTATCGGCTTTGATGACAGCATGATCGCACGATATATCCAACCTCGTCTGACCACAATACGTTATCCTGTTGACATGATGGCTCAGACAGCAACACAGCTGGCACTGGCGCTGGCGTCCTCGCAGGCGCTGCCGTTTTGTCCGCCGTGTTACACACCGACTCTGGTTCTCCGCCACTCGGTGATGAGCAGATTTTCCTGACGAGAATGTGTTAATTTTATTTATTAGTTATCCCTCACTATTTACTTTGG