Homologs in group_2713

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06855 FBDBKF_06855 100.0 Morganella morganii S1 ribC Riboflavin synthase alpha chain
EHELCC_04115 EHELCC_04115 100.0 Morganella morganii S2 ribC Riboflavin synthase alpha chain
LHKJJB_09945 LHKJJB_09945 100.0 Morganella morganii S3 ribC Riboflavin synthase alpha chain
HKOGLL_09030 HKOGLL_09030 100.0 Morganella morganii S5 ribC Riboflavin synthase alpha chain
F4V73_RS01005 F4V73_RS01005 92.4 Morganella psychrotolerans - riboflavin synthase

Distribution of the homologs in the orthogroup group_2713

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2713

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFU9 3.98e-24 93 50 0 88 3 ribE Riboflavin synthase Shigella flexneri
P0AFU8 3.98e-24 93 50 0 88 1 ribC Riboflavin synthase Escherichia coli (strain K12)
P57212 1.04e-18 79 45 0 86 3 ribE Riboflavin synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA22 3.37e-17 75 46 0 86 3 ribE Riboflavin synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P45273 2.08e-15 70 45 0 86 3 ribE Riboflavin synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21578 1.03e-09 55 34 1 85 1 luxY Yellow fluorescent protein Aliivibrio fischeri
O67604 2.76e-09 54 49 0 57 3 ribE Riboflavin synthase Aquifex aeolicus (strain VF5)
Q89AX1 1.46e-08 52 34 0 86 3 ribE Riboflavin synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P80893 1.88e-08 52 35 2 101 1 Y1-BFP Blue fluorescence protein Aliivibrio fischeri
P25082 3.85e-08 51 32 1 85 1 luxL Lumazine protein Photobacterium phosphoreum
P25082 0.000303 40 26 0 88 1 luxL Lumazine protein Photobacterium phosphoreum
Q9Y7P0 4.91e-08 51 32 0 86 1 rib5 Riboflavin synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A5DB51 6.59e-08 51 31 2 94 2 RIB5 Riboflavin synthase Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
P50854 2.73e-07 49 27 1 86 3 ribE Riboflavin synthase Actinobacillus pleuropneumoniae
Q44680 1.15e-06 47 30 1 86 3 ribE Riboflavin synthase Bacillus amyloliquefaciens
Q2YN92 2.2e-06 46 35 0 82 1 ribE Riboflavin synthase Brucella abortus (strain 2308)
Q9Z820 2.35e-06 46 30 0 85 3 ribE Riboflavin synthase Chlamydia pneumoniae
Q06877 2.4e-06 46 32 1 85 1 lumP Lumazine protein Photobacterium leiognathi
Q06877 3.04e-06 46 30 0 84 1 lumP Lumazine protein Photobacterium leiognathi
P16440 3.16e-06 46 30 1 86 1 ribE Riboflavin synthase Bacillus subtilis (strain 168)
P16440 0.000466 40 30 0 83 1 ribE Riboflavin synthase Bacillus subtilis (strain 168)
Q01993 9.58e-05 42 31 0 86 3 ribE Riboflavin synthase Photobacterium leiognathi
P9WK35 0.000558 40 32 3 90 1 ribE Riboflavin synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK34 0.000558 40 32 3 90 3 ribE Riboflavin synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65328 0.000558 40 32 3 90 3 ribE Riboflavin synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P38145 0.000565 40 32 0 55 1 RIB5 Riboflavin synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_04115
Feature type CDS
Gene ribC
Product Riboflavin synthase alpha chain
Location 149328 - 149606 (strand: -1)
Length 279 (nucleotides) / 92 (amino acids)

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2713
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00677 Lumazine binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0307 Coenzyme transport and metabolism (H) H Riboflavin synthase alpha chain

Kegg Ortholog Annotation(s)

Protein Sequence

MDKIFTGVVQGTALILKIEENNDHLIHIVQFPEELLTGLAIGDSVSYNGCCLTVAAIDNSHVGFYLFTDTLLKTALGRLAAGDKVNIERVAV

Flanking regions ( +/- flanking 50bp)

GTTATCCGCTGCGGCTTTTTTGTATCAGTACGGAAAGTGTGAGGTTGGCTTTGGATAAGATTTTTACCGGTGTGGTGCAGGGCACGGCGCTGATTCTAAAAATTGAAGAAAACAATGATCATCTGATTCATATTGTGCAGTTTCCGGAGGAGTTGTTAACGGGGCTGGCGATTGGTGATTCCGTATCGTATAACGGCTGCTGCCTGACTGTCGCAGCGATTGATAACAGCCATGTCGGGTTTTATCTTTTCACCGATACCCTGCTGAAAACCGCGCTCGGGCGGCTGGCTGCGGGTGATAAGGTCAATATCGAAAGAGTGGCGGTCTGATGATATAAAAAAAACCCCGTATCTGACGGGGTTTTTGTTCTGTGAGGGGC