Homologs in group_659

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02290 FBDBKF_02290 100.0 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_02760 EHELCC_02760 100.0 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
LHKJJB_01335 LHKJJB_01335 100.0 Morganella morganii S3 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
HKOGLL_01375 HKOGLL_01375 100.0 Morganella morganii S5 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
F4V73_RS04665 F4V73_RS04665 85.0 Morganella psychrotolerans - ABC transporter ATP-binding protein
F4V73_RS17925 F4V73_RS17925 37.5 Morganella psychrotolerans - AAA family ATPase

Distribution of the homologs in the orthogroup group_659

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_659

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57399 1.48e-55 181 40 1 238 1 molC Molybdate import ATP-binding protein MolC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57243 3.89e-39 139 37 2 223 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P49938 2.77e-34 127 30 1 255 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q9KD30 5.67e-34 125 30 5 233 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q47087 1.94e-33 124 32 2 258 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
Q0SIB7 1.6e-31 120 32 5 256 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
P96117 8.44e-31 117 32 4 231 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
P23878 1.5e-30 117 32 3 258 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
Q81LM1 1.96e-30 117 29 1 241 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
Q57554 7.49e-30 115 33 6 237 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P07821 1.05e-29 115 31 4 247 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q9RKQ4 1.07e-29 115 35 7 252 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O05732 2.03e-29 114 33 1 243 3 HP_0888 Probable iron chelatin transport ATP-binding protein HP_0888 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW3 2.43e-29 114 33 1 243 3 jhp_0821 Probable iron chelatin transport ATP-binding protein jhp_0821 Helicobacter pylori (strain J99 / ATCC 700824)
Q12R52 4.92e-29 112 32 4 240 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q2RZ08 1.04e-28 112 33 7 263 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
O34338 3.41e-28 110 32 5 226 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q9XDA6 3.55e-28 110 29 4 226 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O34510 3.87e-28 110 27 2 258 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q926D8 4.42e-28 110 29 4 226 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q55281 9.16e-28 109 31 5 224 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q56953 1.3e-27 110 31 5 224 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q6D645 3.07e-27 108 34 3 241 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q81V82 3.74e-27 108 29 2 254 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
Q2GFZ6 4.25e-27 107 30 3 185 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q8X5N2 1.34e-26 106 33 5 254 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q5HBR8 1.43e-26 106 30 3 185 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Welgevonden)
Q5FHB0 1.43e-26 106 30 3 185 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Gardel)
Q9WXX8 1.58e-26 105 31 3 188 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q58283 4.39e-26 105 30 2 238 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q3YSK9 4.69e-26 104 27 4 225 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia canis (strain Jake)
O70014 1.1e-25 104 32 5 254 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q2NSR0 1.31e-25 103 33 5 247 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q8FCJ1 1.57e-25 103 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 1.57e-25 103 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
O68877 1.71e-25 103 35 6 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 1.71e-25 103 35 6 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1R597 1.84e-25 103 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q32AY3 2.06e-25 103 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q8UCM5 2.08e-25 103 30 5 267 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
P42360 2.16e-25 103 32 6 233 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q7NN36 4.16e-25 103 32 5 264 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
O32188 5.69e-25 102 30 3 261 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
Q02151 6.18e-25 102 28 4 259 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
Q8EB59 9.25e-25 101 32 4 216 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q13ZJ1 1.42e-24 102 30 4 228 3 nodI Nod factor export ATP-binding protein I Paraburkholderia xenovorans (strain LB400)
Q10V16 2.64e-24 100 31 4 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
P0A2U7 3.02e-24 99 28 2 208 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 3.02e-24 99 28 2 208 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q93SS1 3.64e-24 100 31 7 263 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q66FK0 4.01e-24 100 31 4 247 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 4.01e-24 100 31 4 247 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 4.01e-24 100 31 4 247 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 4.01e-24 100 31 4 247 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q160G4 4.13e-24 100 31 6 252 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5P4W2 4.43e-24 102 36 4 194 3 modC Molybdenum import ATP-binding protein ModC Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q39GT7 6.09e-24 100 30 4 228 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5LBT4 7.07e-24 102 29 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64SQ6 7.21e-24 102 30 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q8XXY9 7.42e-24 100 31 5 229 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1GJU0 7.97e-24 99 30 6 255 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
P74981 8.14e-24 99 32 6 254 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q98FA5 9.2e-24 99 33 4 223 3 thiQ Thiamine import ATP-binding protein ThiQ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q92N13 1.61e-23 98 29 5 255 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q1I4Q5 2.25e-23 98 34 6 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q4K5Z7 2.71e-23 97 32 7 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O69063 3.11e-23 99 31 5 235 3 htxD Hypophosphite import ATP-binding protein HtxD Stutzerimonas stutzeri
O52618 3.2e-23 99 31 6 231 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
Q1J255 3.23e-23 98 32 7 267 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q3SGJ8 3.5e-23 97 31 3 214 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q8A883 3.79e-23 100 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8GNH6 3.93e-23 99 31 6 231 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q82MV1 3.96e-23 97 32 3 211 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q2GJA5 7.1e-23 96 27 4 217 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q9RKC6 9e-23 96 33 6 233 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P54537 1.02e-22 95 30 6 230 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q1H0W2 1.03e-22 96 30 4 253 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
O34946 1.08e-22 95 28 2 203 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q28QF9 1.15e-22 96 30 5 249 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
D4GSY7 1.19e-22 96 30 7 243 3 HVO_1886 Probable anion import ATP-binding protein HVO_1886 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q88DY1 1.36e-22 95 31 5 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9PJX9 1.42e-22 95 36 4 157 3 TC_0697 Probable metal transport system ATP-binding protein TC_0697 Chlamydia muridarum (strain MoPn / Nigg)
P45022 1.64e-22 95 33 5 219 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P48334 1.65e-22 95 28 3 206 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
O84071 1.77e-22 95 30 4 213 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q98L75 1.79e-22 95 30 8 260 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4L885 2.38e-22 95 28 5 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q5GRS1 2.52e-22 95 24 5 226 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q73GK9 2.92e-22 94 27 6 217 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
O84421 3.01e-22 94 35 3 157 3 CT_416 Probable metal transport system ATP-binding protein CT_416 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3JSQ0 3.17e-22 95 30 5 231 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 3.17e-22 95 30 5 231 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q63TX3 3.62e-22 95 30 5 231 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q92AF9 3.77e-22 94 29 4 231 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7N3S7 4.01e-22 95 32 6 254 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2SB47 5.7e-22 94 32 6 254 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q9RZU5 6.79e-22 94 32 7 262 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9Z8J5 7.64e-22 94 32 3 189 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
Q1BWI2 7.8e-22 95 31 4 227 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
A1TXH7 8.45e-22 95 31 6 265 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q58429 8.86e-22 94 27 4 215 3 MJ1023 Uncharacterized ABC transporter ATP-binding protein MJ1023 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0B697 8.94e-22 94 30 3 260 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q47MA5 9.03e-22 94 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
Q160Y9 9.68e-22 93 32 5 215 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5L222 9.96e-22 95 29 7 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q70GD4 1.11e-21 94 30 8 259 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q132E8 1.18e-21 94 28 4 258 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q659V4 1.46e-21 93 30 7 259 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
D5AQY6 1.7e-21 93 33 4 230 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q5PB72 1.88e-21 92 28 4 204 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma marginale (strain St. Maries)
Q9KL34 1.88e-21 93 31 3 238 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5YVL8 2e-21 93 36 6 236 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
P72335 2.06e-21 94 30 6 221 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q9PKX1 2.39e-21 92 30 4 213 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
Q8Y8T6 2.44e-21 94 29 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q31J97 2.52e-21 92 31 7 245 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0AGP9 2.54e-21 94 29 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q7N6Z2 2.75e-21 94 30 3 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3K6R9 2.79e-21 92 32 7 254 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q63NR0 3.09e-21 92 33 5 259 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 3.09e-21 92 33 5 259 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 3.09e-21 92 33 5 259 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q8Z0H0 3.64e-21 93 30 3 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q722B1 3.73e-21 94 29 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q5E5I1 3.76e-21 92 30 5 237 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8D653 3.77e-21 93 31 4 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
P26050 3.8e-21 93 29 5 217 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6F0V4 3.99e-21 93 30 3 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q92DL6 4e-21 94 29 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9CK97 4.16e-21 93 31 7 232 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
P44662 4.21e-21 92 28 6 235 3 HI_0361 Probable iron transport system ATP-binding protein HI_0361 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Y651 4.25e-21 91 29 4 227 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1LKJ2 4.28e-21 92 32 5 218 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q82HA2 4.31e-21 92 32 7 233 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6F9A8 4.38e-21 93 32 4 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9HQ18 4.53e-21 94 33 3 215 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 4.53e-21 94 33 3 215 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q39B28 4.55e-21 92 30 4 260 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1WXT0 4.8e-21 92 29 4 228 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q93SH7 4.83e-21 92 29 5 249 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O57872 5.27e-21 92 35 9 220 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q0S0Z3 5.88e-21 93 33 9 242 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
P56344 6.08e-21 91 30 5 223 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
O34631 6.19e-21 94 30 2 242 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q84EY8 6.46e-21 91 31 4 244 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q2ISN3 7.51e-21 91 28 3 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q7MFA1 7.94e-21 91 31 5 240 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q82WT5 9.27e-21 92 30 4 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P94420 9.71e-21 90 25 3 247 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q8E8K8 1e-20 92 32 6 221 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q28K97 1.01e-20 91 32 4 181 3 tauB Taurine import ATP-binding protein TauB Jannaschia sp. (strain CCS1)
Q8D3S8 1.04e-20 91 32 5 219 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q2SVP3 1.07e-20 92 30 5 230 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q14Q07 1.1e-20 92 26 5 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q6G098 1.21e-20 90 27 6 252 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
P9WQM1 1.25e-20 92 32 3 203 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 1.25e-20 92 32 3 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 1.25e-20 92 32 3 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2SSS4 1.34e-20 92 29 3 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6NBX6 1.36e-20 90 28 3 255 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q87UN0 1.36e-20 90 30 5 230 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4KKK4 1.37e-20 90 32 3 185 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7NX01 1.48e-20 92 33 6 225 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5YRK2 1.49e-20 90 36 3 193 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
O31723 1.55e-20 90 25 2 246 2 ylmA Uncharacterized ABC transporter ATP-binding protein YlmA Bacillus subtilis (strain 168)
Q6FFL0 1.68e-20 90 30 3 185 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q48PV0 1.72e-20 90 31 3 185 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8RHL0 1.79e-20 90 31 4 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6XYZ4 1.83e-20 90 27 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
A1JRI2 2e-20 90 31 5 201 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6MU19 2.16e-20 91 28 3 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q88RL1 2.19e-20 90 31 3 185 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q89AJ0 2.19e-20 89 27 3 185 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0TJC1 2.22e-20 90 33 5 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q325N3 2.44e-20 90 31 2 209 3 tauB Taurine import ATP-binding protein TauB Shigella boydii serotype 4 (strain Sb227)
Q9Z8Q8 2.54e-20 91 30 5 236 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
P23703 2.59e-20 91 29 5 217 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q70YG7 2.61e-20 90 32 6 222 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q2FVF1 2.72e-20 89 28 7 236 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9Z3I3 3.09e-20 90 29 5 216 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q8U3E0 3.26e-20 89 30 7 233 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2T3B8 3.43e-20 89 32 4 240 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3KKA1 3.61e-20 89 31 3 185 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q3Z542 3.76e-20 89 31 2 209 3 tauB Taurine import ATP-binding protein TauB Shigella sonnei (strain Ss046)
Q47538 3.76e-20 89 31 2 209 2 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain K12)
Q8X5I6 3.76e-20 89 31 2 209 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
A0A0H3JT74 3.9e-20 89 29 7 236 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1CDR0 4.18e-20 89 33 5 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 4.18e-20 89 33 5 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 4.18e-20 89 33 5 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
O07016 4.25e-20 90 31 5 206 3 yvfR Uncharacterized ABC transporter ATP-binding protein YvfR Bacillus subtilis (strain 168)
Q8FKF5 4.62e-20 89 31 2 209 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q665B6 4.73e-20 89 33 5 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q92CK1 4.74e-20 89 31 8 235 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y7R4 4.94e-20 89 31 8 235 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7W9U5 5.5e-20 90 32 3 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGW1 5.67e-20 90 32 3 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8L1U3 5.74e-20 89 30 6 255 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 5.74e-20 89 30 6 255 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q1LNM0 5.88e-20 89 33 5 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9G4F5 6.07e-20 90 31 5 229 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q1IGY7 6.58e-20 89 31 3 185 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q8NR42 6.64e-20 88 33 4 200 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q32IZ6 6.69e-20 89 31 2 209 3 tauB Taurine import ATP-binding protein TauB Shigella dysenteriae serotype 1 (strain Sd197)
Q4ZZS2 7.55e-20 89 29 5 230 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q73YZ5 7.59e-20 88 36 3 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 7.59e-20 88 36 3 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q2K551 7.72e-20 89 28 7 263 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6G0V9 7.89e-20 87 34 2 180 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Bartonella quintana (strain Toulouse)
Q07LY2 8.02e-20 89 27 3 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q6LQC0 8.6e-20 89 33 11 257 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q21GS5 9.91e-20 90 33 4 202 3 modC Molybdenum import ATP-binding protein ModC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1RFH8 1.03e-19 88 31 2 209 3 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain UTI89 / UPEC)
Q0TKS1 1.03e-19 88 31 2 209 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7A169 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MW2)
Q6GAB5 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MSSA476)
Q6GHY6 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MRSA252)
Q7A679 1.05e-19 90 31 7 207 1 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain N315)
Q99V03 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY5 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain COL)
Q2YX74 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2A7 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHY1 1.05e-19 90 31 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain USA300)
Q5YZY9 1.06e-19 89 31 4 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q87J32 1.11e-19 88 30 4 234 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q66AT7 1.12e-19 88 28 7 245 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q92VJ2 1.16e-19 89 31 8 238 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q0SBZ1 1.16e-19 89 33 9 242 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q5WBL0 1.17e-19 87 29 2 210 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q1CJG3 1.17e-19 88 31 5 186 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.17e-19 88 31 5 186 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.17e-19 88 31 5 186 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
O51587 1.29e-19 89 26 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6NA00 1.41e-19 88 29 5 265 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0RT43 1.55e-19 88 32 2 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q0SRL2 1.62e-19 89 26 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q0RYP7 1.65e-19 89 32 8 242 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
P44735 1.73e-19 90 30 4 209 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 3.27e-12 68 27 7 225 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P14788 1.9e-19 89 29 3 221 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7VZE5 2.14e-19 89 32 3 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q93DX8 2.15e-19 87 31 4 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q2JLH7 2.2e-19 87 30 5 205 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q73XU8 2.2e-19 89 32 3 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q4QN44 2.2e-19 90 30 4 209 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 4.09e-12 68 27 7 222 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q0SML1 2.25e-19 89 26 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q9KHT9 2.32e-19 89 28 4 219 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 2.32e-19 89 28 4 219 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q660M8 2.34e-19 89 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q5YRD1 2.37e-19 88 32 5 215 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q9Z810 2.4e-19 87 36 3 161 3 CPn_0542 Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 Chlamydia pneumoniae
O31339 2.54e-19 89 31 4 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
P9WQL3 2.59e-19 89 32 2 212 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 2.59e-19 89 32 2 212 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q92V71 2.84e-19 87 30 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q7MFH3 2.99e-19 89 29 8 248 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 1.04e-07 55 24 6 229 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q3SJC6 3.02e-19 88 32 2 192 3 modC Molybdenum import ATP-binding protein ModC Thiobacillus denitrificans (strain ATCC 25259)
Q1BJA5 3.04e-19 87 30 5 263 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 3.04e-19 87 30 5 263 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q720M2 3.09e-19 87 30 8 235 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q1MCZ1 3.21e-19 87 29 6 239 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q110U3 3.25e-19 89 31 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q138A9 3.29e-19 87 30 6 246 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
P54954 3.29e-19 86 31 5 216 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
Q8DIA0 3.34e-19 88 32 5 197 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q72FW5 3.35e-19 88 33 7 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9C9W0 3.36e-19 87 33 6 210 2 ABCI17 ABC transporter I family member 17 Arabidopsis thaliana
Q5NN23 3.45e-19 86 28 3 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9AE30 3.45e-19 87 28 6 249 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q1RDS4 3.61e-19 86 32 5 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 3.61e-19 86 32 5 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q81GU1 3.63e-19 88 31 4 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6RCE0 4.13e-19 87 31 8 248 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q1M7W6 4.21e-19 87 29 5 226 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6NBT1 4.27e-19 88 30 7 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8G838 4.42e-19 89 30 7 247 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 3.48e-12 69 27 4 205 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q3ICT8 4.61e-19 86 29 6 245 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q5LVM5 4.61e-19 86 32 5 183 3 tauB Taurine import ATP-binding protein TauB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q83MA0 4.67e-19 86 31 2 209 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri
Q16BJ3 4.75e-19 86 32 4 181 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P72477 4.82e-19 86 25 3 248 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8D3Z9 5.04e-19 89 29 8 248 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 3.19e-07 54 24 6 229 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8XIZ5 5.48e-19 87 26 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 5.48e-19 87 26 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8ELR4 5.49e-19 88 28 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0RKH4 5.5e-19 86 31 1 222 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q11ID5 5.7e-19 86 29 7 252 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q20Y31 5.75e-19 86 28 4 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q6CYU2 5.95e-19 86 29 3 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q30V33 5.97e-19 87 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2KDV1 6.04e-19 86 29 6 246 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q035B2 6.08e-19 86 34 6 223 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8KZQ6 6.08e-19 86 34 5 199 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q07LU3 7.23e-19 86 30 7 243 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q8H1R4 7.5e-19 86 30 5 203 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
A0KPH6 7.51e-19 85 26 4 229 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6FFZ1 7.57e-19 86 29 3 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P10346 7.86e-19 85 29 5 225 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q49WM4 8.39e-19 87 30 7 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9V2E4 8.73e-19 85 34 7 213 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q92XW1 8.93e-19 87 31 6 241 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q8U648 9.23e-19 85 31 5 196 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6N7Y6 9.52e-19 85 32 7 234 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q87SV4 9.61e-19 85 30 4 226 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4QK57 1.02e-18 87 30 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
P45171 1.04e-18 87 30 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5ZWE4 1.18e-18 87 29 5 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8XZP8 1.21e-18 87 32 5 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6LTB1 1.23e-18 85 29 3 185 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
P74548 1.31e-18 86 27 2 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5JEB0 1.31e-18 86 31 4 200 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9I2N4 1.4e-18 86 32 3 194 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8TYV9 1.4e-18 85 31 4 214 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8FYU9 1.42e-18 85 30 4 221 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella suis biovar 1 (strain 1330)
Q8YJ04 1.42e-18 85 30 4 221 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q55740 1.51e-18 85 31 6 229 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1LC89 1.54e-18 85 29 4 253 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6G475 1.69e-18 85 26 5 248 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q217B2 1.71e-18 85 33 8 226 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
A0A0H2ZLL3 1.76e-18 84 28 5 230 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q981Y8 1.76e-18 84 33 3 203 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q88YN5 1.78e-18 85 31 7 219 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q57BC2 1.78e-18 84 30 4 221 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus biovar 1 (strain 9-941)
Q2YLW6 1.78e-18 84 30 4 221 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus (strain 2308)
Q2IYS5 1.79e-18 85 31 5 207 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q1GMA8 1.81e-18 85 27 5 243 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q8KLG1 1.81e-18 85 26 4 226 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03ZQ0 1.84e-18 86 27 3 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q3IWB5 1.91e-18 84 31 4 201 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q5WXF0 1.91e-18 86 29 5 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q6D0F3 1.94e-18 84 31 4 224 3 thiQ Thiamine import ATP-binding protein ThiQ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9TKX3 1.98e-18 86 32 9 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q89ER4 2.02e-18 85 29 3 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8FJ95 2.04e-18 84 32 5 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34677 2.05e-18 84 29 5 219 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
O68106 2.06e-18 85 32 4 216 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q3E9B8 2.16e-18 87 27 7 254 2 ABCG23 ABC transporter G family member 23 Arabidopsis thaliana
Q0SK28 2.21e-18 84 32 3 181 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
Q31I51 2.21e-18 84 28 2 187 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2JGF5 2.29e-18 85 30 2 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q1RGL1 2.33e-18 84 28 4 185 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q6LQ00 2.46e-18 87 29 6 244 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 4.79e-08 56 21 6 228 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
O69051 2.47e-18 85 30 7 266 3 ptxA Phosphite import ATP-binding protein PxtA Stutzerimonas stutzeri
Q5MZ53 2.55e-18 85 29 4 217 3 cmpD Bicarbonate transport ATP-binding protein CmpD Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55108 2.55e-18 85 29 4 217 1 cmpD Bicarbonate transport ATP-binding protein CmpD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8U4L3 2.56e-18 84 34 11 223 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3IM24 2.65e-18 84 29 6 234 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q0VTB6 2.79e-18 84 33 6 191 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SPI3 2.8e-18 84 31 4 186 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q6GEL3 2.97e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q2YYM4 2.97e-18 84 28 3 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A470 3.09e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 3.09e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7MPC5 3.27e-18 84 30 4 223 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 3.27e-18 84 30 4 223 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q5PDF8 3.29e-18 84 32 2 199 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8RQL7 3.33e-18 84 30 6 214 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q02QT1 3.37e-18 84 32 3 202 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1MQ44 3.43e-18 85 29 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q3ISC1 3.45e-18 83 32 5 233 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q5HDY6 3.49e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 3.49e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 3.49e-18 84 27 3 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q881U6 3.5e-18 83 29 6 224 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3M5J9 3.58e-18 84 30 4 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7UX73 3.71e-18 83 33 9 232 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q89C51 3.79e-18 84 28 4 254 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1RD28 3.92e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 3.92e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q6D201 3.98e-18 85 30 5 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8ZRV2 4.01e-18 83 31 3 225 1 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0T7M2 4.09e-18 84 30 2 209 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri serotype 5b (strain 8401)
Q73EL7 4.23e-18 85 30 6 233 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
P69877 4.25e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
Q32EY4 4.25e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
P69874 4.25e-18 85 33 7 223 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 4.25e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 4.25e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 4.25e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q8Z9I6 4.26e-18 83 32 2 199 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q62K82 4.29e-18 85 29 4 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q63TY1 4.33e-18 85 29 4 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q65UE1 4.47e-18 85 30 6 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1B9H9 4.53e-18 83 33 4 212 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q8RD43 4.59e-18 86 26 3 235 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 2.52e-11 66 21 7 221 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9HYG4 4.66e-18 84 32 3 202 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NIW1 4.71e-18 85 30 4 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A1BC20 4.72e-18 83 33 2 204 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paracoccus denitrificans (strain Pd 1222)
Q88R93 4.72e-18 84 33 4 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4K441 4.72e-18 84 32 4 206 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0T5R2 4.73e-18 85 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q1B8U4 4.76e-18 83 31 3 214 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium sp. (strain MCS)
Q1QE80 4.77e-18 85 32 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q92G36 5.05e-18 83 27 3 185 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q55DW4 5.13e-18 86 34 8 205 3 abcG1 ABC transporter G family member 1 Dictyostelium discoideum
Q98DT6 5.25e-18 84 30 2 202 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1IGL4 5.28e-18 84 31 4 208 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q9RR46 5.52e-18 85 30 2 221 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
P37494 5.6e-18 82 30 6 207 3 yybJ Uncharacterized ABC transporter ATP-binding protein YybJ Bacillus subtilis (strain 168)
Q9C8K2 5.67e-18 86 33 6 215 1 ABCG12 ABC transporter G family member 12 Arabidopsis thaliana
Q7MNI7 5.72e-18 84 27 5 239 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 5.72e-18 84 27 5 239 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
O85818 5.85e-18 85 30 6 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q5PBP5 5.97e-18 82 29 2 185 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Anaplasma marginale (strain St. Maries)
Q87S48 6.08e-18 84 27 5 239 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LV32 6.24e-18 83 29 4 233 3 thiQ Thiamine import ATP-binding protein ThiQ Photobacterium profundum (strain SS9)
Q72AQ6 6.25e-18 83 29 5 235 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q0BUR6 6.77e-18 83 33 3 201 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q48IB9 7e-18 82 29 7 236 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9CP98 7.16e-18 85 29 2 189 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 7.49e-12 67 27 7 222 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q6G529 7.34e-18 82 32 4 184 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2SJY7 7.45e-18 84 31 6 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q65T42 7.47e-18 84 29 5 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q608V9 8.27e-18 84 32 5 193 3 modC Molybdenum import ATP-binding protein ModC Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P08720 8.36e-18 84 29 5 226 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q82CD3 8.64e-18 83 29 2 208 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8Z5W6 9.05e-18 82 31 4 185 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q1GBJ0 9.99e-18 83 31 4 208 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P75370 1.12e-17 82 24 4 237 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q4ZLS1 1.12e-17 83 32 4 207 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
P9WQK1 1.14e-17 82 31 4 197 1 Rv0986 Uncharacterized ABC transporter ATP-binding protein Rv0986 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK0 1.14e-17 82 31 4 197 3 MT1014 Uncharacterized ABC transporter ATP-binding protein MT1014 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q326G9 1.14e-17 82 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q7ULB5 1.15e-17 85 32 5 206 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9HPH7 1.17e-17 82 30 5 218 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q04EY5 1.19e-17 83 29 5 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P46903 1.19e-17 82 28 3 201 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
Q0A9E2 1.21e-17 82 28 4 203 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q04BY7 1.24e-17 83 31 4 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q4KC87 1.24e-17 84 32 8 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q04G50 1.26e-17 84 27 5 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P48243 1.27e-17 82 28 4 218 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6HP89 1.29e-17 84 30 6 233 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q4FMG5 1.3e-17 82 29 5 184 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q4ZTG9 1.32e-17 82 30 6 236 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q81ZF5 1.33e-17 84 30 6 233 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
P55476 1.35e-17 84 29 5 228 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P31060 1.39e-17 84 30 6 210 2 modF ABC transporter ATP-binding protein ModF Escherichia coli (strain K12)
P31060 1.32e-06 52 26 5 209 2 modF ABC transporter ATP-binding protein ModF Escherichia coli (strain K12)
Q5PIA5 1.4e-17 82 31 4 185 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 1.4e-17 82 31 4 185 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
P44656 1.45e-17 82 30 6 227 3 HI_0354 Uncharacterized ABC transporter ATP-binding protein HI_0354 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57TF5 1.51e-17 82 32 2 199 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
Q18AM3 1.52e-17 84 26 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q3Z5U5 1.52e-17 82 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q6LR20 1.53e-17 84 32 7 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q3K506 1.53e-17 82 31 3 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q21XJ9 1.58e-17 82 30 3 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q0T8D1 1.67e-17 82 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
Q9M0G9 1.68e-17 84 30 6 216 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
Q8ZNV7 1.72e-17 82 31 4 185 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3Z2Z3 1.75e-17 84 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.75e-17 84 33 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q9AB70 1.77e-17 82 29 6 243 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6D4E2 1.79e-17 84 32 8 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q18KE1 1.79e-17 83 30 5 229 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q4KG27 1.85e-17 81 33 5 187 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q46ZU5 1.88e-17 82 31 4 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8UH62 1.9e-17 83 27 5 249 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q63GR8 1.92e-17 83 30 6 233 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q8RCU0 1.92e-17 82 29 7 217 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8A1M1 1.93e-17 81 28 4 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8U4K3 1.97e-17 83 30 6 211 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q5LT05 2.13e-17 83 31 3 187 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q03EE4 2.2e-17 82 26 5 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q9JZW0 2.22e-17 83 27 3 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q49W48 2.22e-17 83 29 5 231 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1MMZ3 2.27e-17 82 28 6 246 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6D4A8 2.4e-17 81 31 5 186 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q609Q1 2.48e-17 83 30 4 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9JUX4 2.62e-17 83 27 3 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P77622 2.66e-17 82 27 4 216 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q8NVB5 2.72e-17 82 27 3 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 2.72e-17 82 27 3 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q0K9I2 2.72e-17 82 31 4 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9MUN1 2.94e-17 82 28 4 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q73P71 2.95e-17 81 30 7 241 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q4UJW5 2.95e-17 81 27 3 185 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A0A125QXJ1 3.01e-17 84 29 8 234 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q6AE21 3.02e-17 82 33 5 214 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
P77795 3.09e-17 82 29 4 215 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
Q9NP58 3.12e-17 84 31 8 234 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q5WC31 3.21e-17 83 26 5 247 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5WC31 1.71e-11 67 23 6 214 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
O34992 3.28e-17 83 27 6 242 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q83MG3 3.31e-17 80 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q8FL82 3.52e-17 80 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1U776 3.52e-17 81 33 6 187 3 znuC Zinc import ATP-binding protein ZnuC Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q63E84 3.53e-17 82 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 3.53e-17 82 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 3.53e-17 82 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q7MMN0 3.59e-17 81 28 3 185 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 3.59e-17 81 28 3 185 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q65VG9 3.7e-17 82 28 8 255 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1J0N0 3.76e-17 81 30 7 230 3 pstB Phosphate import ATP-binding protein PstB Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q21JK3 3.8e-17 80 30 5 191 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1WVI7 3.88e-17 82 27 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q9DC29 3.88e-17 83 30 8 234 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q1M7A6 3.93e-17 81 29 2 208 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q48CA0 3.97e-17 81 32 4 207 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6HLQ9 4.02e-17 82 27 3 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q0TLS2 4.02e-17 80 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q664P8 4.1e-17 81 31 3 210 3 tauB Taurine import ATP-binding protein TauB Yersinia pseudotuberculosis serotype I (strain IP32953)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_00700
Feature type CDS
Gene fepC
Product ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Location 146463 - 147203 (strand: 1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_659
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1120 Inorganic ion transport and metabolism (P)
Coenzyme transport and metabolism (H)
PH ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MIRVNQLSYHTGKRPLFDGLTFRQPPGTIAAILGPNGRGKTTLLRLLLSLQKGATGTVQLSAPAAYVPQLSGALFNYSVRTMVSLGRVRHLPWYASPSRRDHDITDQAMADLGLTPFADTPFNLLSGGEKQMVMIARALAGEPDILILDEPTSALDLANQDTVLSVLKMLAAERGKTILFTSHYPQHALHIADHSLLLFDGTQAQFGQTPALLTEENLGKLYQLPVSVVPVNHPHRHTCGVIPLFR

Flanking regions ( +/- flanking 50bp)

CCGATTTTCGCCCTGCTCATTCACTCCATGAATAAAAAGGTGGCAGACCTGTGATCCGTGTTAATCAGCTCAGTTACCACACCGGCAAACGTCCGTTATTTGACGGACTGACATTCCGCCAGCCGCCGGGTACTATCGCCGCTATTCTCGGCCCGAACGGCCGCGGAAAAACCACGCTGCTGCGCCTGCTGCTCAGCCTGCAAAAAGGGGCAACCGGCACTGTGCAGCTCAGTGCACCGGCAGCCTATGTGCCGCAACTCAGCGGTGCGCTGTTTAATTACTCTGTCCGCACCATGGTCAGCCTCGGCAGGGTTCGCCATCTTCCCTGGTATGCCTCCCCGTCCCGGCGTGATCATGACATCACCGACCAGGCAATGGCTGACCTCGGATTAACGCCGTTTGCGGACACCCCATTTAACCTGCTCAGCGGCGGTGAAAAACAGATGGTGATGATTGCCCGCGCACTGGCCGGTGAACCGGACATTCTGATCCTGGATGAACCCACTTCCGCGCTGGATCTGGCAAATCAGGACACGGTTCTTTCCGTTCTGAAAATGCTGGCCGCCGAACGCGGCAAAACCATCCTGTTTACCAGCCATTATCCGCAGCATGCCCTGCATATTGCGGATCACTCACTGTTACTGTTTGACGGCACACAGGCGCAGTTTGGTCAGACACCCGCACTGCTGACTGAAGAGAACCTGGGAAAGCTGTATCAGCTTCCGGTTTCTGTCGTGCCGGTTAACCACCCGCACCGGCATACCTGCGGCGTGATCCCGCTGTTCCGCTGAACCCATTTATTACCTGATTAACCATAAGGATACTTATTATGAGCAATAAC