Homologs in group_2568

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02735 FBDBKF_02735 100.0 Morganella morganii S1 tadA tRNA(Arg) A34 adenosine deaminase TadA
EHELCC_03205 EHELCC_03205 100.0 Morganella morganii S2 tadA tRNA(Arg) A34 adenosine deaminase TadA
LHKJJB_01780 LHKJJB_01780 100.0 Morganella morganii S3 tadA tRNA(Arg) A34 adenosine deaminase TadA
HKOGLL_01820 HKOGLL_01820 100.0 Morganella morganii S5 tadA tRNA(Arg) A34 adenosine deaminase TadA
F4V73_RS05215 F4V73_RS05215 80.3 Morganella psychrotolerans - nucleoside deaminase

Distribution of the homologs in the orthogroup group_2568

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2568

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34598 2.52e-25 97 36 2 153 1 guaD Guanine deaminase Bacillus subtilis (strain 168)
Q94BU8 3.57e-24 95 42 2 121 1 GSDA Guanosine deaminase Arabidopsis thaliana
P57343 1.07e-20 85 31 3 151 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O67050 1.11e-20 85 39 0 100 1 tadA tRNA-specific adenosine deaminase Aquifex aeolicus (strain VF5)
Q89AM8 1.04e-19 83 32 3 155 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7CQ08 1.79e-19 82 39 1 109 3 tadA tRNA-specific adenosine deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGY4 1.79e-19 82 39 1 109 3 tadA tRNA-specific adenosine deaminase Salmonella typhi
P68397 1.88e-19 82 38 1 109 3 tadA tRNA-specific adenosine deaminase Shigella flexneri
P68398 1.88e-19 82 38 1 109 1 tadA tRNA-specific adenosine deaminase Escherichia coli (strain K12)
Q8FF24 2.27e-19 82 38 1 109 3 tadA tRNA-specific adenosine deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XA44 2.27e-19 82 38 1 109 3 tadA tRNA-specific adenosine deaminase Escherichia coli O157:H7
Q8K9R4 3.16e-19 81 35 1 109 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9S7I0 3.21e-16 77 38 0 101 1 TADA tRNA(adenine(34)) deaminase, chloroplastic Arabidopsis thaliana
Q99W51 1e-15 72 36 0 97 1 tadA tRNA-specific adenosine deaminase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P44931 1.85e-15 72 36 1 102 3 tadA tRNA-specific adenosine deaminase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5RIV4 3.56e-14 70 32 4 140 2 adat2 tRNA-specific adenosine deaminase 2 Danio rerio
P21335 4e-14 68 37 0 97 1 tadA tRNA-specific adenosine deaminase Bacillus subtilis (strain 168)
A9CK16 7.57e-14 67 37 0 96 1 tadA tRNA-specific adenosine deaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
P68999 1.48e-13 67 32 0 98 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M1
P0DA21 1.56e-13 67 32 0 98 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XE14 1.56e-13 67 32 0 98 1 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA20 1.56e-13 67 32 0 98 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8P2R7 1.72e-13 67 32 0 98 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M18 (strain MGAS8232)
C1D1Q9 4.69e-12 65 41 1 105 3 tilS tRNA(Ile)-lysidine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
P78594 1.99e-11 61 30 2 97 3 FCA1 Cytosine deaminase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q7Z6V5 2e-11 62 30 1 105 1 ADAT2 tRNA-specific adenosine deaminase 2 Homo sapiens
Q6P6J0 5.47e-11 61 30 1 105 1 Adat2 tRNA-specific adenosine deaminase 2 Mus musculus
Q0P4H0 1.03e-10 60 26 4 153 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus tropicalis
Q5E9J7 1.05e-10 60 30 1 105 2 DEADC1 tRNA-specific adenosine deaminase 2 Bos taurus
O59834 5.23e-10 57 30 1 101 3 SPCC965.14c Probable cytosine deaminase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9ZCC6 1.17e-09 56 31 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia prowazekii (strain Madrid E)
Q4V7V8 3.02e-09 56 28 5 133 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus laevis
Q68Y02 5.39e-09 55 30 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92G39 7.76e-08 52 31 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9RV23 7.96e-08 53 45 1 88 3 tilS tRNA(Ile)-lysidine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q5SI38 1.05e-07 53 42 3 84 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IF6 1.08e-07 53 42 3 84 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q1RGK7 1.2e-07 51 31 1 87 3 tadA tRNA-specific adenosine deaminase Rickettsia bellii (strain RML369-C)
Q4UJW9 1.47e-07 50 31 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q12178 8.72e-07 49 31 2 82 1 FCY1 Cytosine deaminase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P25539 1.58e-06 49 33 5 118 1 ribD Riboflavin biosynthesis protein RibD Escherichia coli (strain K12)
Q6IDB6 2.39e-06 48 23 2 109 1 TAD2 tRNA-specific adenosine deaminase TAD2 Arabidopsis thaliana
P44326 8.7e-06 47 30 6 152 3 ribD Riboflavin biosynthesis protein RibD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B6TRH4 4.07e-05 45 32 6 114 2 PYRD Riboflavin biosynthesis protein PYRD, chloroplastic Zea mays
Q4R683 6.6e-05 45 37 3 90 2 CDADC1 Cytidine and dCMP deaminase domain-containing protein 1 Macaca fascicularis
Q5RAX4 6.72e-05 45 37 3 90 2 CDADC1 Cytidine and dCMP deaminase domain-containing protein 1 Pongo abelii
Q9BWV3 6.85e-05 45 37 3 90 1 CDADC1 Cytidine and dCMP deaminase domain-containing protein 1 Homo sapiens
O94642 0.000165 43 30 1 76 1 tad2 tRNA-specific adenosine deaminase subunit tad2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8GWP5 0.000167 43 30 6 124 1 PYRD Riboflavin biosynthesis protein PYRD, chloroplastic Arabidopsis thaliana
O66534 0.000804 42 31 5 108 3 ribD Riboflavin biosynthesis protein RibD Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_00255
Feature type CDS
Gene tadA
Product tRNA(Arg) A34 adenosine deaminase TadA
Location 47739 - 48197 (strand: 1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2568
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00383 Cytidine and deoxycytidylate deaminase zinc-binding region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0590 Translation, ribosomal structure and biogenesis (J) J tRNA(Arg) A34 adenosine deaminase TadA

Protein Sequence

MTDSEFLAQAIALARRNAEKGGRPFGAVVVRNGEIVGEGVNQMLELHDPTAHAELLALRHAGNNLRQTRLEDCVVYASGQPCPMCLAAMRMAGVTRAVYAYSNADAEPYGLSTASIALALRADPHEQTGFSFTQQKPEGEPSLYDFWQQKQN

Flanking regions ( +/- flanking 50bp)

AGGGGAAAGCCATATGGGAATCCCCGTTAATCAATCATAAGGAATAACTGATGACAGATAGTGAATTTCTGGCTCAGGCGATAGCACTGGCCCGCCGGAATGCCGAAAAGGGCGGTCGCCCGTTTGGTGCCGTTGTGGTCAGAAACGGGGAAATTGTCGGTGAAGGGGTTAATCAGATGCTTGAGCTGCATGACCCGACCGCTCATGCGGAATTGCTGGCTCTGCGCCATGCCGGTAACAACCTCCGGCAGACCCGGCTGGAAGATTGTGTGGTGTATGCCAGCGGACAGCCATGCCCGATGTGTCTTGCCGCAATGCGGATGGCGGGTGTGACCCGTGCTGTCTATGCTTATTCCAATGCGGATGCGGAACCTTACGGTTTATCAACAGCATCCATTGCACTGGCTTTACGGGCCGATCCGCATGAACAAACGGGCTTCTCTTTTACACAGCAAAAACCGGAAGGTGAGCCATCACTGTATGATTTCTGGCAGCAAAAACAGAACTGATTATAGTTGCCACTGATGCTGCCGGGTTTCCGGCAGCCGGTATTCCTGAT