Homologs in group_2596

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02735 FBDBKF_02735 80.3 Morganella morganii S1 tadA tRNA(Arg) A34 adenosine deaminase TadA
EHELCC_03205 EHELCC_03205 80.3 Morganella morganii S2 tadA tRNA(Arg) A34 adenosine deaminase TadA
NLDBIP_00255 NLDBIP_00255 80.3 Morganella morganii S4 tadA tRNA(Arg) A34 adenosine deaminase TadA
LHKJJB_01780 LHKJJB_01780 80.3 Morganella morganii S3 tadA tRNA(Arg) A34 adenosine deaminase TadA
HKOGLL_01820 HKOGLL_01820 80.3 Morganella morganii S5 tadA tRNA(Arg) A34 adenosine deaminase TadA

Distribution of the homologs in the orthogroup group_2596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34598 1.65e-30 110 40 2 149 1 guaD Guanine deaminase Bacillus subtilis (strain 168)
O67050 3.44e-25 97 44 0 100 1 tadA tRNA-specific adenosine deaminase Aquifex aeolicus (strain VF5)
Q94BU8 1.41e-23 94 39 2 121 1 GSDA Guanosine deaminase Arabidopsis thaliana
A9CK16 6.06e-20 83 44 1 100 1 tadA tRNA-specific adenosine deaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q99W51 2.81e-19 82 41 0 97 1 tadA tRNA-specific adenosine deaminase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P57343 9.96e-19 80 37 2 125 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AM8 1.31e-17 77 37 0 108 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9R4 3.07e-17 76 37 0 106 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P68397 1.38e-16 75 38 0 94 3 tadA tRNA-specific adenosine deaminase Shigella flexneri
P68398 1.38e-16 75 38 0 94 1 tadA tRNA-specific adenosine deaminase Escherichia coli (strain K12)
Q7CQ08 1.63e-16 75 36 0 105 3 tadA tRNA-specific adenosine deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGY4 1.63e-16 75 36 0 105 3 tadA tRNA-specific adenosine deaminase Salmonella typhi
Q8FF24 1.74e-16 75 38 0 94 3 tadA tRNA-specific adenosine deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XA44 1.74e-16 75 38 0 94 3 tadA tRNA-specific adenosine deaminase Escherichia coli O157:H7
P21335 1.77e-16 74 37 0 97 1 tadA tRNA-specific adenosine deaminase Bacillus subtilis (strain 168)
P0DA21 2.42e-16 74 37 1 105 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XE14 2.42e-16 74 37 1 105 1 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA20 2.42e-16 74 37 1 105 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68999 2.55e-16 74 37 1 105 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M1
Q8P2R7 2.57e-16 74 37 1 105 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9S7I0 4.2e-16 77 37 0 101 1 TADA tRNA(adenine(34)) deaminase, chloroplastic Arabidopsis thaliana
P44931 5.07e-15 71 37 1 102 3 tadA tRNA-specific adenosine deaminase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C1D1Q9 3.85e-14 71 40 1 110 3 tilS tRNA(Ile)-lysidine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q5RIV4 4.11e-12 64 31 3 135 2 adat2 tRNA-specific adenosine deaminase 2 Danio rerio
P78594 9.73e-12 62 32 2 97 3 FCA1 Cytosine deaminase Candida albicans (strain SC5314 / ATCC MYA-2876)
O59834 2.72e-11 61 35 4 105 3 SPCC965.14c Probable cytosine deaminase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1RGK7 8.22e-11 59 33 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia bellii (strain RML369-C)
Q0P4H0 1.22e-10 59 26 3 135 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus tropicalis
Q68Y02 1.25e-10 59 32 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q7Z6V5 1.29e-10 60 27 2 107 1 ADAT2 tRNA-specific adenosine deaminase 2 Homo sapiens
Q9ZCC6 1.62e-10 58 32 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia prowazekii (strain Madrid E)
Q6P6J0 5.58e-10 58 28 2 107 1 Adat2 tRNA-specific adenosine deaminase 2 Mus musculus
Q5E9J7 7.22e-10 58 27 2 107 2 DEADC1 tRNA-specific adenosine deaminase 2 Bos taurus
Q92G39 1.21e-09 56 32 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q6IDB6 1.24e-09 57 30 2 111 1 TAD2 tRNA-specific adenosine deaminase TAD2 Arabidopsis thaliana
Q4UJW9 2.49e-09 55 33 1 100 3 tadA tRNA-specific adenosine deaminase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9RV23 1.19e-08 55 42 1 95 3 tilS tRNA(Ile)-lysidine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q4V7V8 2.27e-08 53 23 2 134 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus laevis
P25539 6.45e-08 53 33 5 118 1 ribD Riboflavin biosynthesis protein RibD Escherichia coli (strain K12)
Q5SI38 9.85e-08 53 39 3 86 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IF6 9.94e-08 53 39 3 86 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q12178 8.2e-07 49 32 3 103 1 FCY1 Cytosine deaminase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O66534 1.17e-06 50 34 6 108 3 ribD Riboflavin biosynthesis protein RibD Aquifex aeolicus (strain VF5)
P57533 8.89e-05 43 32 6 116 3 ribD1 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AB0 0.000239 43 27 5 108 3 ribD Riboflavin biosynthesis protein RibD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P47058 0.000504 42 23 2 103 1 TAD2 tRNA-specific adenosine deaminase subunit TAD2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05215
Feature type CDS
Gene -
Product nucleoside deaminase
Location 1110504 - 1110962 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2596
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00383 Cytidine and deoxycytidylate deaminase zinc-binding region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0590 Translation, ribosomal structure and biogenesis (J) J tRNA(Arg) A34 adenosine deaminase TadA

Protein Sequence

MADKQFLQQAIALARRNIEKGGRPFGAVIVKDGKIISEGVNQMAELNDPTAHAELLALRHAGQTLGQTRLEGCVVYASGQPCPMCLAAMRMAGITRAVYAYSNSDAQPYGLSTELIAVALRADPHEQTGFSFTQQKPDDEPSLYAQWQAHQH

Flanking regions ( +/- flanking 50bp)

ATATCCGGCTGTTATGATGAATATCGTTGACTGGTTAATAAGGATCGGGAATGGCTGACAAACAGTTTTTGCAGCAGGCGATTGCACTCGCACGCCGCAATATTGAAAAAGGCGGACGTCCGTTCGGCGCTGTTATAGTGAAAGACGGCAAAATTATCAGCGAAGGTGTTAATCAGATGGCTGAACTGAATGATCCGACGGCACATGCAGAGTTGCTGGCATTGCGCCATGCCGGACAGACACTCGGTCAGACCCGGCTGGAAGGTTGTGTGGTTTACGCCAGTGGTCAGCCGTGTCCGATGTGTCTGGCTGCTATGCGCATGGCAGGCATTACCCGGGCGGTTTATGCTTATTCCAATTCCGATGCACAGCCCTATGGCTTATCAACAGAGTTGATTGCCGTGGCATTGCGCGCGGATCCTCATGAGCAGACCGGATTTTCGTTTACACAACAAAAACCGGATGATGAGCCGTCTCTGTATGCACAATGGCAGGCGCATCAGCATTAAATTATCATAGGGACGGTCGCGGCTTCCGGCGGCGGCTGTTTCTGTTATAA