Homologs in group_3049

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18215 FBDBKF_18215 100.0 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_18250 EHELCC_18250 100.0 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_18175 NLDBIP_18175 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_18105 HKOGLL_18105 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
PMI_RS15430 PMI_RS15430 43.5 Proteus mirabilis HI4320 - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_3049

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3049

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77559 1.84e-25 106 28 5 278 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
Q04778 3.72e-23 100 26 4 284 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
P07774 1.53e-19 90 26 4 266 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P52670 2.31e-19 89 27 5 280 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O68014 7.06e-18 85 24 4 266 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q47141 9.18e-18 85 27 7 286 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P94403 2.76e-17 83 28 3 249 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
Q05840 8.11e-17 82 28 7 282 3 clcR HTH-type transcriptional regulator ClcR Pseudomonas putida
O33945 2.19e-16 81 26 6 278 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
P42427 5.5e-16 79 34 2 154 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q47005 8e-16 79 26 3 249 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
P77309 1.04e-15 79 25 10 286 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
P20667 1.07e-15 79 28 8 268 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
Q08597 3.28e-15 77 27 5 251 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
P37499 1.59e-14 75 26 5 253 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
P39592 2.61e-14 75 24 8 287 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
P52666 8.11e-14 73 27 2 277 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
Q81VJ1 5.74e-13 71 27 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
P77744 8.8e-13 70 29 8 254 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
P94387 3.08e-12 69 26 8 276 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
Q6HPH4 4.25e-12 68 26 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81IX0 4.29e-12 68 26 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q63H01 4.95e-12 68 26 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 4.95e-12 68 26 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
O06703 1.02e-11 68 29 1 157 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A0R8S0 1.48e-11 67 26 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
Q46M57 3.42e-11 66 31 1 148 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46M54 3.79e-11 66 31 1 148 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P52669 4.21e-11 65 25 7 290 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P05827 4.23e-11 65 26 6 249 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
P70785 4.9e-11 65 26 9 287 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P0A2Q2 5.38e-11 65 26 6 249 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 5.38e-11 65 26 6 249 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P71025 7.15e-11 65 24 6 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
P0ACR8 8.29e-11 65 25 5 252 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 8.29e-11 65 25 5 252 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P52665 1.12e-10 62 34 2 143 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P23841 1.51e-10 64 25 4 266 3 xapR HTH-type transcriptional regulator XapR Escherichia coli (strain K12)
Q9I6Z9 3.05e-10 63 37 0 96 3 bauR HTH-type transcriptional activator BauR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q329U3 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
B6I4A0 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
B7M5B2 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B7NU32 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YY14 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
A7ZTW7 3.54e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YVK2 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q31UM0 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B1LLU0 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
P0A8R9 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7UMM1 3.67e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LUJ5 3.71e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NF72 3.74e-10 63 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R4H3 4.35e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 4.35e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 4.35e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 4.35e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 4.35e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
O35038 4.35e-10 63 29 5 162 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
B2TU26 4.87e-10 62 39 1 87 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A4QH19 5.92e-10 62 23 6 282 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
P43161 6.67e-10 62 29 4 164 3 mprR Small neutral protease regulatory protein Streptomyces lividans
Q9L127 8.9e-10 62 29 4 164 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B4TNR5 1.26e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
P20668 1.32e-09 61 26 8 284 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
P52667 1.43e-09 61 30 2 148 3 estR HTH-type transcriptional regulator EstR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P0A2Q0 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5FN59 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
B5EZ22 1.48e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
A7Z5E4 1.51e-09 61 28 7 248 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B4SYF7 1.58e-09 61 37 1 87 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
P44418 1.61e-09 61 24 3 245 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P55181 2.37e-09 60 27 9 254 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
P43160 2.62e-09 60 27 9 270 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor
O34685 3.03e-09 60 26 7 249 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
P52686 3.46e-09 60 39 0 97 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
P71318 8.33e-09 59 23 11 316 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
A1JI47 9.17e-09 58 41 0 73 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P52662 1.09e-08 58 24 7 275 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
P52696 1.52e-08 58 40 0 80 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
P52691 2.13e-08 57 25 8 268 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P27102 2.73e-08 57 26 5 259 3 tcbR HTH-type transcriptional regulator TcbR Pseudomonas sp. (strain P51)
B1JQ39 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 3.09e-08 57 39 0 76 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8YQ82 3.68e-08 57 26 3 194 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P45105 4.07e-08 57 27 3 147 3 cysB HTH-type transcriptional regulator CysB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9X725 5.23e-08 57 24 6 255 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P52659 6.33e-08 56 48 0 64 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
P0ACQ4 8.67e-08 56 24 8 297 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 8.67e-08 56 24 8 297 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 8.67e-08 56 24 8 297 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
P52661 9.88e-08 56 28 1 149 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
A0T0V5 1.23e-07 55 26 2 172 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P77171 1.26e-07 55 25 11 314 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
O19892 1.48e-07 55 22 5 253 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P94678 1.78e-07 55 28 1 145 1 tsaR HTH-type transcriptional regulator TsaR Comamonas testosteroni
P72294 2.07e-07 55 27 10 286 3 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium meliloti
O32186 2.99e-07 54 27 10 277 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
P0ACQ9 3.09e-07 54 21 3 245 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 3.09e-07 54 21 3 245 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 3.09e-07 54 21 3 245 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
Q3MCB5 3.71e-07 54 25 3 194 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P27111 3.98e-07 54 27 8 253 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
P0A4T3 4.27e-07 53 29 6 198 1 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium radiobacter
P0A4T4 4.27e-07 53 29 6 198 1 occR Octopine catabolism/uptake operon regulatory protein OccR Agrobacterium tumefaciens (strain Ach5)
P52678 4.48e-07 53 26 7 277 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P39127 4.69e-07 53 26 1 157 3 citR HTH-type transcriptional regulator CitR Bacillus subtilis (strain 168)
O69055 6.02e-07 52 26 2 145 3 ptxE Putative HTH-type transcriptional regulator protein PtxE (Fragment) Stutzerimonas stutzeri
P73123 6.57e-07 53 25 3 194 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P96194 6.76e-07 51 41 0 73 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
Q8X4M5 1.23e-06 52 26 7 253 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
Q1XDT2 1.3e-06 52 24 2 171 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
Q8VWE6 1.45e-06 52 26 8 259 3 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli O157:H7
P45463 1.57e-06 52 27 2 129 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
Q0TD46 1.72e-06 52 27 2 129 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B4E8S9 1.76e-06 52 25 8 240 1 ssuR HTH-type transcriptional regulator SsuR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q8XBK9 1.79e-06 52 27 2 129 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
P51205 1.82e-06 52 24 2 171 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
P36771 1.92e-06 52 26 8 259 1 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli (strain K12)
Q1R6S1 1.92e-06 52 27 2 129 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 1.92e-06 52 27 2 129 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q57S50 2.31e-06 52 39 0 68 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
Q9S4Y7 2.42e-06 52 39 0 68 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 2.42e-06 52 39 0 68 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P25544 2.49e-06 51 27 2 172 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
O87883 3.07e-06 50 30 4 190 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P33634 3.62e-06 51 28 3 149 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P24734 4.06e-06 51 46 0 66 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P94501 4.21e-06 51 24 6 252 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
P0ACR0 4.5e-06 50 33 2 96 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 4.5e-06 50 33 2 96 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
P34818 4.52e-06 50 31 1 121 3 trpI HTH-type transcriptional regulator TrpI Pseudomonas syringae pv. syringae
P0A9G1 5.88e-06 50 25 9 254 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 5.88e-06 50 25 9 254 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 5.88e-06 50 25 9 254 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
Q8Z8R3 6.13e-06 50 39 0 68 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P0DV33 6.2e-06 50 27 2 158 1 admX HTH-type transcriptional regulator AdmX Serratia plymuthica
O87324 6.37e-06 50 33 3 148 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
O34701 7.35e-06 50 34 1 97 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
P52679 9.71e-06 50 24 7 243 1 pcpR PCP degradation transcriptional activation protein Sphingobium chlorophenolicum
Q8FK66 9.83e-06 50 33 2 96 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 9.83e-06 50 33 2 96 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RF30 1.04e-05 50 39 0 68 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 1.04e-05 50 39 0 68 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
P12529 1.21e-05 49 29 2 129 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
Q4G384 1.31e-05 49 22 1 168 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
P49518 1.41e-05 49 24 4 179 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P44821 1.73e-05 49 22 3 178 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52676 2.1e-05 48 41 0 67 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
O32255 2.49e-05 48 21 9 269 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
O07906 2.65e-05 48 25 3 136 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P45099 3.33e-05 48 28 4 146 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q00678 3.53e-05 48 29 4 137 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
P45461 3.68e-05 48 43 0 64 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
Q6B936 3.75e-05 48 23 2 175 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
P35112 4.72e-05 47 29 4 137 3 nocR Regulatory protein NocR Agrobacterium tumefaciens (strain T37)
P42722 4.82e-05 47 24 6 250 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A0T0G2 0.000116 46 21 6 252 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
P0A4T7 0.000131 46 26 4 157 3 pcaQ HTH-type transcriptional regulator PcaQ Rhizobium radiobacter
P0A4T6 0.000131 46 26 4 157 3 pcaQ HTH-type transcriptional regulator PcaQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P77700 0.000133 46 23 1 141 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P96725 0.000134 46 24 11 259 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
Q765S2 0.00014 46 33 2 96 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
P0A2Q4 0.000145 46 27 4 169 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 0.000145 46 27 4 169 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P52677 0.000153 46 26 5 273 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
P25545 0.000164 46 28 0 148 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
P48271 0.000174 46 24 2 171 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
P11720 0.000186 45 33 3 124 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52658 0.000248 45 38 0 67 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P45349 0.000331 45 29 0 96 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52693 0.000634 44 27 4 148 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P39647 0.000644 44 19 5 271 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
P05051 0.000651 44 42 0 64 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
P45600 0.000678 44 31 2 76 1 cysB HTH-type transcriptional regulator CysB Klebsiella pneumoniae
P06614 0.000783 44 31 2 76 1 cysB HTH-type transcriptional regulator CysB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18370
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 9081 - 9998 (strand: 1)
Length 918 (nucleotides) / 305 (amino acids)

Contig

Accession ZDB_383
Length 35029 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3049
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MDLRLLRAFVTLAGCGHYHEAASVLCITQPALTKQIKLLENRLGLTLFVRGRHGAQLTAEGAELLPAATALVTQSREFMHHAARLSRQLPAQLNVGFGISAFKEAAEFVSRLQRTLPDVQVSLDDFPSQVMTEKLLSGELDIAFMRLPLPENTVHCPEAVAFKQETLSLAVPAGTVVQPGQELSLITRNPLLTLHENRGAGLYHQITAFLDANHVTPQAVHYSSDIRTLIALVAAGAGVALLPGEAGDPGHPDVSFYPLTDFAQACWKMGMVWRRELPLLWRQQWREWLTVKDHPFGFGKPGSPV

Flanking regions ( +/- flanking 50bp)

ATGCCGGTCAGGTTATGCTCATGACCGGCATCTCAGACAGGATAATCAGCATGGATCTGCGTTTACTGCGGGCATTTGTGACACTGGCCGGTTGCGGACATTATCATGAGGCCGCATCCGTCCTTTGCATTACCCAGCCCGCACTGACCAAACAGATAAAACTGCTGGAGAACAGACTCGGGCTGACACTGTTTGTGCGCGGACGGCACGGTGCTCAACTGACGGCGGAGGGCGCTGAATTATTACCGGCGGCCACGGCGCTGGTGACACAGAGCCGGGAGTTTATGCATCATGCGGCGCGGCTGAGCCGTCAGTTACCGGCGCAGCTGAATGTCGGGTTCGGTATTTCGGCATTTAAAGAAGCGGCTGAATTTGTCAGCCGGCTGCAAAGAACACTGCCGGATGTGCAGGTGTCTCTGGATGATTTCCCCTCTCAGGTGATGACTGAAAAATTACTTTCCGGTGAACTGGATATCGCCTTTATGCGCCTGCCGCTGCCGGAAAATACGGTTCACTGCCCGGAAGCTGTTGCCTTTAAGCAGGAAACATTATCTCTCGCGGTACCGGCCGGAACTGTAGTGCAGCCCGGTCAGGAATTGTCACTGATCACCCGCAATCCGCTGCTGACATTGCATGAAAACCGGGGCGCGGGGCTGTATCACCAGATAACGGCATTTCTGGATGCTAATCATGTTACCCCGCAGGCGGTGCACTACAGCAGTGATATCCGGACACTGATTGCCCTGGTGGCGGCCGGTGCCGGTGTCGCTCTCCTGCCCGGCGAAGCCGGTGATCCGGGGCATCCGGATGTTTCGTTTTACCCGCTGACTGACTTTGCACAGGCATGCTGGAAGATGGGTATGGTCTGGCGGCGTGAGTTACCGCTTCTCTGGCGGCAGCAGTGGCGCGAGTGGCTGACAGTAAAAGATCACCCGTTCGGTTTCGGTAAACCCGGGAGCCCGGTGTAACAACTGCGATGCGGTGTTATCCGGTGAGGTATAGGAGGCCGGTTCGCGGC