Homologs in group_3009

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17595 FBDBKF_17595 100.0 Morganella morganii S1 soxR DNA-binding transcriptional regulator, MerR family
EHELCC_18080 EHELCC_18080 100.0 Morganella morganii S2 soxR DNA-binding transcriptional regulator, MerR family
NLDBIP_18070 NLDBIP_18070 100.0 Morganella morganii S4 soxR DNA-binding transcriptional regulator, MerR family
HKOGLL_17935 HKOGLL_17935 100.0 Morganella morganii S5 soxR DNA-binding transcriptional regulator, MerR family
F4V73_RS14975 F4V73_RS14975 79.8 Morganella psychrotolerans - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_3009

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3009

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96690 1.45e-12 69 33 1 105 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)
P39842 6.49e-10 61 25 5 217 4 bltR Multidrug-efflux transporter 2 regulator Bacillus subtilis (strain 168)
P39075 9.5e-10 61 35 1 101 1 bmrR Multidrug-efflux transporter 1 regulator Bacillus subtilis (strain 168)
P22896 2.6e-08 54 43 1 67 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P44558 3.2e-08 54 33 4 114 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV30 6.61e-06 48 23 2 109 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A9G5 2.36e-05 46 25 3 112 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 2.36e-05 46 25 3 112 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8XD09 5.87e-05 45 26 3 105 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
Q8FK74 8.09e-05 45 26 3 105 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44617 0.000109 44 27 3 118 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22874 0.000174 43 28 3 107 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
P22853 0.000195 43 25 4 112 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P45277 0.000345 43 27 4 106 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P58379 0.000508 42 22 3 123 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
B8H172 0.000773 43 26 2 102 3 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV4 0.000773 43 26 2 102 1 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18265
Feature type CDS
Gene soxR
Product DNA-binding transcriptional regulator, MerR family
Location 23889 - 24692 (strand: 1)
Length 804 (nucleotides) / 267 (amino acids)
In genomic island -

Contig

Accession ZDB_382
Length 38736 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3009
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19575 MerR family transcriptional regulator, activator of bmr gene - -

Protein Sequence

MKKYFTIGETAALLGVSTQTLRFYDKKSILKPGYTDNENGYRYYTFEQFHYIDRIKYLQKMNMSLSDIKTIMESGDKNKLTEYLIQEKSRKLQQMAELKKTIETLDWYLDYFTFTDNKPRNGAFYTTELPERWCLFVPCYPADRPISKMELRLAEMKARPENQSLDYLRQYAYVLDYQNIIEQTFYPSKYLIYLKEKPDFDSPNLVCLPAGFYLCCICHYLSENIDAEMVKRYFHGKEKPRMVIANEFEDNLVSYESAPYELQFLIS

Flanking regions ( +/- flanking 50bp)

TTTTAAATCTGATAATTTAAATAAAAGTAATTATTTTACGGGCAGCAATCATGAAGAAATATTTTACTATCGGGGAAACTGCCGCGCTATTAGGCGTTTCAACGCAGACACTGCGTTTTTATGATAAAAAATCCATTCTCAAACCCGGTTATACGGATAATGAAAACGGATACCGTTATTATACATTTGAACAGTTTCATTATATCGACAGAATTAAATATCTTCAGAAAATGAATATGAGCCTGAGTGATATTAAAACCATTATGGAAAGTGGTGATAAAAATAAATTAACCGAATATTTAATTCAGGAAAAATCCCGCAAATTACAGCAGATGGCAGAATTAAAAAAGACCATTGAAACACTGGACTGGTATCTGGATTATTTTACCTTCACTGATAATAAACCGCGTAACGGGGCTTTTTATACTACCGAATTACCGGAACGCTGGTGTCTGTTTGTTCCCTGTTATCCGGCAGATCGTCCGATTTCAAAAATGGAACTGCGGCTGGCTGAAATGAAAGCCCGGCCGGAAAATCAGTCCCTCGATTATCTGCGGCAGTATGCCTATGTGCTGGATTATCAAAACATTATTGAGCAAACCTTTTATCCGTCGAAATACCTGATTTACCTGAAAGAGAAACCGGATTTTGATTCTCCTAACCTGGTGTGTTTACCGGCCGGGTTTTATCTTTGCTGTATCTGTCATTATCTCAGTGAAAATATCGATGCTGAAATGGTGAAACGTTATTTCCACGGAAAAGAAAAACCACGGATGGTTATCGCCAATGAATTTGAAGATAACCTGGTCAGTTATGAATCCGCCCCTTATGAACTGCAATTTCTGATTTCATAATGTACCCGCAAAAAAAACGGCCTGATAATCGTTATTATCAGGCCGTGAGT