Homologs in group_3002

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17595 FBDBKF_17595 79.8 Morganella morganii S1 soxR DNA-binding transcriptional regulator, MerR family
EHELCC_18080 EHELCC_18080 79.8 Morganella morganii S2 soxR DNA-binding transcriptional regulator, MerR family
NLDBIP_18070 NLDBIP_18070 79.8 Morganella morganii S4 soxR DNA-binding transcriptional regulator, MerR family
LHKJJB_18265 LHKJJB_18265 79.8 Morganella morganii S3 soxR DNA-binding transcriptional regulator, MerR family
HKOGLL_17935 HKOGLL_17935 79.8 Morganella morganii S5 soxR DNA-binding transcriptional regulator, MerR family

Distribution of the homologs in the orthogroup group_3002

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3002

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96690 6.77e-14 73 40 1 97 4 ydfL Uncharacterized HTH-type transcriptional regulator YdfL Bacillus subtilis (strain 168)
P39075 3.23e-11 65 38 0 92 1 bmrR Multidrug-efflux transporter 1 regulator Bacillus subtilis (strain 168)
P39842 1.46e-10 63 26 5 226 4 bltR Multidrug-efflux transporter 2 regulator Bacillus subtilis (strain 168)
P22896 1.53e-08 55 33 2 106 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P44558 3.1e-06 48 31 4 116 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44617 4.86e-06 48 28 2 118 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9G5 0.000142 44 23 3 122 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 0.000142 44 23 3 122 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8XD09 0.000181 43 22 2 109 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
B8H172 0.000202 45 28 2 102 3 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV4 0.000202 45 28 2 102 1 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8FK74 0.000205 43 28 1 63 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P22853 0.000293 43 28 2 106 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
Q93CH6 0.000634 42 24 4 130 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z8S3 0.000806 42 25 5 130 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q9HV30 0.000881 42 25 2 109 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14975
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 233276 - 234079 (strand: -1)
Length 804 (nucleotides) / 267 (amino acids)

Contig

Accession term accessions NZ_VXKB01000004 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3002
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19575 MerR family transcriptional regulator, activator of bmr gene - -

Protein Sequence

MKKYFTIGETAKLLGISTQTLRFYDKKGILKPGYVDSETGYRYYLFEQFHYIDRIKYLQKLNMNLSDIKIIIESGDKEKLTHYLIQERKRKEQQLKDLHGMIETLDWYVDYFSFVDNKSGGEPFYSVELPERWCLFVPCYPSDRPISKMELRLAEMKSKPENKSLSYLRQYAYVLDYNNIIDQTFYPSKYLIYLKEKPDFDSPNLVCLPAGLYLCCICNYLSEKVDIVMVEQYFKDKDKPGLVIANEFEDNLVNYDSAPYELQFLIS

Flanking regions ( +/- flanking 50bp)

ATTTTAAATCTGATAGTTTAAATAAAAGTGACATTTACCCGGGAAAGAATATGAAAAAATATTTTACAATTGGTGAAACAGCCAAATTATTAGGTATTTCAACACAAACGCTACGTTTTTATGATAAAAAAGGCATTCTGAAACCGGGATATGTCGATAGTGAAACCGGATATCGTTACTATCTGTTTGAACAATTTCATTACATTGACCGAATTAAGTATCTTCAAAAGCTAAATATGAATTTAAGTGATATTAAAATCATTATTGAAAGCGGGGATAAAGAAAAATTAACACATTATTTAATACAGGAAAGAAAGCGGAAGGAGCAGCAACTGAAAGATTTGCATGGCATGATAGAAACATTAGACTGGTATGTTGATTACTTCAGTTTTGTTGATAATAAGTCAGGGGGTGAACCTTTTTACAGTGTTGAACTGCCGGAACGCTGGTGTCTGTTTGTTCCCTGCTATCCCTCAGACCGCCCCATTTCTAAGATGGAACTGAGACTGGCAGAAATGAAATCCAAGCCGGAAAATAAATCACTTTCTTATTTACGGCAATATGCCTATGTTCTGGATTATAATAATATTATTGATCAAACATTTTATCCGTCAAAATACCTTATCTATCTGAAAGAAAAACCAGACTTTGATTCACCCAACCTGGTTTGCCTGCCGGCAGGATTATACCTGTGCTGTATTTGTAATTATCTTTCTGAAAAGGTTGATATTGTTATGGTGGAACAATATTTCAAAGATAAAGATAAACCAGGACTGGTTATTGCAAATGAATTTGAAGATAATTTAGTTAATTATGACTCAGCACCCTATGAACTTCAGTTCCTTATTTCATAAAGAAAGATTTATTTATCTATTATTATGTAACGCCCGCTTTTCCGGAAAAT