Homologs in group_2156

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15920 FBDBKF_15920 100.0 Morganella morganii S1 lrp DNA-binding transcriptional regulator, Lrp family
EHELCC_18520 EHELCC_18520 100.0 Morganella morganii S2 lrp DNA-binding transcriptional regulator, Lrp family
NLDBIP_17355 NLDBIP_17355 100.0 Morganella morganii S4 lrp DNA-binding transcriptional regulator, Lrp family
HKOGLL_17090 HKOGLL_17090 100.0 Morganella morganii S5 lrp DNA-binding transcriptional regulator, Lrp family
F4V73_RS16390 F4V73_RS16390 91.8 Morganella psychrotolerans - Lrp/AsnC family transcriptional regulator
PMI_RS00595 PMI_RS00595 82.4 Proteus mirabilis HI4320 - Lrp/AsnC family transcriptional regulator

Distribution of the homologs in the orthogroup group_2156

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2156

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACJ5 5.61e-78 231 70 0 151 1 decR DNA-binding transcriptional activator DecR Escherichia coli (strain K12)
P0ACJ6 5.61e-78 231 70 0 151 3 decR DNA-binding transcriptional activator DecR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ7 5.61e-78 231 70 0 151 3 decR DNA-binding transcriptional activator DecR Escherichia coli O157:H7
P0DJA5 2.84e-48 157 46 1 152 3 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
F8DT92 3.07e-48 157 46 1 152 4 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
P0DJA6 9.02e-33 117 36 1 150 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P42179 1.25e-32 117 36 1 151 4 bkdR Bkd operon transcriptional regulator Pseudomonas putida
F8DT24 1.71e-32 116 36 1 150 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
Q9I1M3 2.33e-26 100 32 0 150 3 bkdR Bkd operon transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37424 5.34e-26 100 34 0 153 3 lrp Leucine-responsive regulatory protein Klebsiella pneumoniae
P0A2S0 6.56e-26 100 34 0 153 3 lrp Leucine-responsive regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37425 7.54e-26 99 34 0 153 3 lrp Leucine-responsive regulatory protein Serratia marcescens
P0ACJ3 8.05e-26 99 34 0 153 3 lrp Leucine-responsive regulatory protein Shigella flexneri
P0ACJ4 8.05e-26 99 34 0 153 3 lrp Leucine-responsive regulatory protein Klebsiella aerogenes
P0ACJ0 8.05e-26 99 34 0 153 1 lrp Leucine-responsive regulatory protein Escherichia coli (strain K12)
P0ACJ1 8.05e-26 99 34 0 153 3 lrp Leucine-responsive regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ2 8.05e-26 99 34 0 153 3 lrp Leucine-responsive regulatory protein Escherichia coli O157:H7
O07920 3.97e-25 97 33 0 155 4 azlB Transcriptional regulator AzlB Bacillus subtilis (strain 168)
P44580 1.12e-24 97 36 0 126 4 HI_0224 Uncharacterized HTH-type transcriptional regulator HI_0224 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44333 2.41e-23 93 34 0 147 4 putR Proline dehydrogenase transcriptional activator Rhizobium radiobacter
P45265 1.22e-21 89 35 0 148 3 lrp Leucine-responsive regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O59188 3.43e-19 82 26 2 150 1 fl11 HTH-type transcriptional regulator FL11 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P50337 7.25e-19 80 31 0 116 4 NGR_a01600 Uncharacterized HTH-type transcriptional regulator y4sM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q52710 7.62e-19 81 30 0 144 4 putR Proline dehydrogenase transcriptional activator Rhodobacter capsulatus
E1V7V9 7.7e-18 79 31 0 119 3 doeX Transcriptional regulatory protein DoeX Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
P55658 8.79e-18 79 28 0 150 4 NGR_a01550 Uncharacterized HTH-type transcriptional regulator y4tD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8U0P3 1.65e-17 77 25 2 151 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9V0Y9 1.04e-16 75 25 2 150 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus abyssi (strain GE5 / Orsay)
P56901 2.85e-16 74 28 0 143 3 lrp Leucine-responsive regulatory protein Rhizobium meliloti (strain 1021)
O59579 1.72e-13 67 34 0 110 4 PH1916 Uncharacterized HTH-type transcriptional regulator PH1916 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UY16 2.76e-13 67 34 0 111 4 PYRAB16920 Uncharacterized HTH-type transcriptional regulator PYRAB16920 Pyrococcus abyssi (strain GE5 / Orsay)
Q9V2D7 3.39e-13 66 30 1 130 4 PYRAB01370 Uncharacterized HTH-type transcriptional regulator PYRAB01370 Pyrococcus abyssi (strain GE5 / Orsay)
O57880 6.44e-13 66 30 1 130 1 PH0140 Uncharacterized HTH-type transcriptional regulator PH0140 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U445 1.93e-12 64 32 0 115 4 PF0250 Uncharacterized HTH-type transcriptional regulator PF0250 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P96582 4.08e-12 63 27 1 122 1 lrpC HTH-type transcriptional regulator LrpC Bacillus subtilis (strain 168)
Q8U067 9.54e-12 62 29 2 143 4 PF1734 Uncharacterized HTH-type transcriptional regulator PF1734 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O31497 8.53e-10 57 26 2 137 4 yezC Uncharacterized HTH-type transcriptional regulator YezC Bacillus subtilis (strain 168)
O59309 2.86e-09 56 25 2 143 4 PH1692 Uncharacterized HTH-type transcriptional regulator PH1692 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U4M7 4.64e-09 55 25 0 123 4 PF0054 Uncharacterized HTH-type transcriptional regulator PF0054 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O05217 8.52e-09 55 24 2 148 4 ywrC Uncharacterized HTH-type transcriptional regulator YwrC Bacillus subtilis (strain 168)
Q9V1E5 1.37e-08 54 23 2 144 4 PYRAB04820 Uncharacterized HTH-type transcriptional regulator PYRAB04820 Pyrococcus abyssi (strain GE5 / Orsay)
O57818 2.18e-08 53 24 0 123 4 PH0045 Uncharacterized HTH-type transcriptional regulator PH0045 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q58133 2.19e-08 53 20 1 143 1 ptr2 HTH-type transcriptional regulator Ptr2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P42180 4.41e-08 52 23 1 144 1 lrpA HTH-type transcriptional regulator LrpA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P96652 5.06e-08 52 26 1 124 4 lrpA HTH-type transcriptional regulator LrpA Bacillus subtilis (strain 168)
P96653 7.04e-08 52 24 1 124 4 lrpB HTH-type transcriptional regulator LrpB Bacillus subtilis (strain 168)
O59256 8.1e-08 52 23 1 144 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V159 8.36e-08 52 24 1 144 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus abyssi (strain GE5 / Orsay)
Q57615 2.21e-07 51 24 1 120 1 ptr1 HTH-type transcriptional regulator Ptr1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U1H7 1.73e-06 48 24 1 120 4 PF1231 Uncharacterized HTH-type transcriptional regulator PF1231 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B0R717 3.81e-06 47 26 1 120 4 lrp HTH-type transcriptional regulator Lrp Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q46CH6 9.69e-05 44 28 4 107 1 ahbA Siroheme decarboxylase alpha subunit Methanosarcina barkeri (strain Fusaro / DSM 804)
O57802 0.000392 42 33 1 75 1 PH0061 Uncharacterized HTH-type transcriptional regulator PH0061 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P44337 0.000715 41 22 1 108 3 asnC Regulatory protein AsnC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17305
Feature type CDS
Gene lrp
Product DNA-binding transcriptional regulator, Lrp family
Location 33606 - 34121 (strand: -1)
Length 516 (nucleotides) / 171 (amino acids)
In genomic island -

Contig

Accession ZDB_378
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2156
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01037 Lrp/AsnC ligand binding domain
PF13412 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1522 Transcription (K) K DNA-binding transcriptional regulator, Lrp family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05800 Lrp/AsnC family transcriptional regulator, cysteine-sensing transcriptional activator - -

Protein Sequence

MHDMEKFILSGGDMLDKTDRKLLQLLQEDAALSLNTLSEAVNLTSTPCWKRLKRLEDEGYIRKRVALLDPEKLGLGLTVIVMIKTQHHSSEWYTQFVEFVQQMPDVVEFYRMAGEFDYMLQVEVVDMKCFDHFYKKLVNGVPGLIDVTSNFAMERIKYTTALPIPEKCKAD

Flanking regions ( +/- flanking 50bp)

TGCATCTTAGCAATTCTGTGAGAGAAAAGGCTTTTTCTATTTTCTGTATCATGCATGATATGGAGAAATTTATTCTCTCTGGTGGTGATATGTTAGATAAAACAGACCGTAAATTGTTACAACTTTTGCAGGAAGATGCTGCATTATCACTGAACACCCTGTCCGAAGCGGTGAACCTGACATCCACTCCCTGCTGGAAACGGCTGAAACGGCTGGAAGATGAAGGGTATATCCGCAAACGTGTGGCGCTGCTGGACCCGGAGAAGCTCGGGCTGGGACTGACGGTGATCGTCATGATCAAGACACAGCACCACAGCAGTGAGTGGTATACTCAGTTTGTGGAATTTGTTCAGCAGATGCCTGATGTGGTGGAGTTTTACCGGATGGCCGGGGAATTTGACTACATGCTGCAGGTCGAGGTGGTGGACATGAAATGCTTCGATCATTTTTACAAAAAACTGGTTAACGGTGTGCCCGGTTTAATTGATGTGACTTCCAATTTTGCGATGGAGCGCATAAAGTACACCACCGCATTGCCGATTCCGGAGAAATGCAAAGCGGACTGATTATTAACCTGAGATGTTATACGGGATCCTGTGAGATTATTTGCCCAATT