Homologs in group_2125

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15975 FBDBKF_15975 100.0 Morganella morganii S1 acrR multidrug efflux transporter transcriptional repressor AcrR
EHELCC_18580 EHELCC_18580 100.0 Morganella morganii S2 acrR multidrug efflux transporter transcriptional repressor AcrR
NLDBIP_17410 NLDBIP_17410 100.0 Morganella morganii S4 acrR multidrug efflux transporter transcriptional repressor AcrR
HKOGLL_17145 HKOGLL_17145 100.0 Morganella morganii S5 acrR multidrug efflux transporter transcriptional repressor AcrR
F4V73_RS16335 F4V73_RS16335 89.8 Morganella psychrotolerans acrR multidrug efflux transporter transcriptional repressor AcrR
PMI_RS00645 PMI_RS00645 63.1 Proteus mirabilis HI4320 acrR multidrug efflux transporter transcriptional repressor AcrR

Distribution of the homologs in the orthogroup group_2125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACT1 1.52e-72 222 49 0 214 3 acrR HTH-type transcriptional regulator AcrR Shigella flexneri
P0ACS9 1.52e-72 222 49 0 214 1 acrR HTH-type transcriptional regulator AcrR Escherichia coli (strain K12)
P0ACT0 1.52e-72 222 49 0 214 3 acrR HTH-type transcriptional regulator AcrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9AIU0 1.13e-43 148 38 0 209 1 ttgR HTH-type transcriptional regulator TtgR Pseudomonas putida (strain DOT-T1E)
Q88N29 1.19e-43 148 38 0 209 3 ttgR Probable HTH-type transcriptional regulator TtgR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KJC4 1.19e-43 148 38 0 209 3 arpR Probable HTH-type transcriptional regulator ArpR Pseudomonas putida
P0C068 2.39e-42 145 38 0 209 3 mepR Probable HTH-type transcriptional regulator MepR Pseudomonas putida
P0ACT2 6.32e-39 136 35 1 208 4 envR Probable acrEF/envCD operon repressor Escherichia coli (strain K12)
P0ACT3 6.32e-39 136 35 1 208 3 envR Probable acrEF/envCD operon repressor Escherichia coli O157:H7
P39897 2.5e-28 108 34 2 201 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
Q8G2M8 2.61e-25 101 32 3 190 1 bepR HTH-type transcriptional repressor BepR Brucella suis biovar 1 (strain 1330)
Q9R9T9 2.87e-20 88 34 6 187 1 srpR HTH-type transcriptional regulator SrpR Pseudomonas putida
Q93PU7 2.32e-16 75 54 0 64 1 ttgW Uncharacterized HTH-type transcriptional regulator TtgW Pseudomonas putida (strain DOT-T1E)
P94548 2.86e-10 60 27 6 181 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
O31500 1.22e-06 51 31 1 77 4 yerO Uncharacterized HTH-type transcriptional regulator YerO Bacillus subtilis (strain 168)
A0R4Z6 1.45e-06 50 38 0 62 1 kstR2 HTH-type transcriptional repressor KstR2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P96701 2.37e-06 49 23 2 178 4 ydgC Uncharacterized HTH-type transcriptional regulator YdgC Bacillus subtilis (strain 168)
Q5HKQ1 2.82e-06 49 37 1 54 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8GLC6 2.88e-06 49 37 1 54 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis
Q79ZV4 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MW2)
Q6G609 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MSSA476)
Q6GDD9 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MRSA252)
Q7A352 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain N315)
Q7A2K5 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKF4 3.37e-06 49 38 0 49 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Newman)
Q5HCN2 3.37e-06 49 38 0 49 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain COL)
Q9RQQ0 3.37e-06 49 38 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GDM3 1.15e-05 47 41 0 53 4 SAR2658 HTH-type transcriptional regulator SAR2658 Staphylococcus aureus (strain MRSA252)
Q99R60 1.19e-05 47 41 0 53 4 SAV2578 HTH-type transcriptional regulator SAV2578 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q79ZX9 1.19e-05 47 41 0 53 4 MW2498 HTH-type transcriptional regulator MW2498 Staphylococcus aureus (strain MW2)
Q6G696 1.19e-05 47 41 0 53 4 SAS2464 HTH-type transcriptional regulator SAS2464 Staphylococcus aureus (strain MSSA476)
Q7A3C7 1.19e-05 47 41 0 53 4 SA2364 HTH-type transcriptional regulator SA2364 Staphylococcus aureus (strain N315)
Q2FV42 1.29e-05 47 41 0 53 4 SAOUHSC_02897 HTH-type transcriptional regulator SAOUHSC_02897 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HCX3 1.29e-05 47 41 0 53 4 SACOL2593 HTH-type transcriptional regulator SACOL2593 Staphylococcus aureus (strain COL)
Q2FDS9 1.29e-05 47 41 0 53 4 SAUSA300_2515 HTH-type transcriptional regulator SAUSA300_2515 Staphylococcus aureus (strain USA300)
Q0S7V2 2.05e-05 47 37 1 61 1 kstR2 HTH-type transcriptional repressor KstR2 Rhodococcus jostii (strain RHA1)
P95251 2.42e-05 47 37 0 61 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2YWD0 2.54e-05 46 41 0 53 4 SAB2452 HTH-type transcriptional regulator SAB2452 Staphylococcus aureus (strain bovine RF122 / ET3-1)
P28815 5.66e-05 45 38 1 62 1 tetC Transposon Tn10 TetC protein Escherichia coli
P32398 0.000108 45 40 0 52 4 yhgD Uncharacterized HTH-type transcriptional regulator YhgD Bacillus subtilis (strain 168)
P9WMB9 0.000168 44 31 3 85 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 0.000168 44 31 3 85 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O53165 0.000198 44 33 0 59 1 Rv1474c HTH-type transcriptional repressor Rv1474c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O31560 0.0003 43 23 7 197 1 yfiR Uncharacterized HTH-type transcriptional regulator YfiR Bacillus subtilis (strain 168)
B5Y006 0.000343 43 44 0 47 3 betI HTH-type transcriptional regulator BetI Klebsiella pneumoniae (strain 342)
P0A0N5 0.000546 42 33 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus haemolyticus
P0A0N4 0.000546 42 33 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus
P0A0N3 0.000546 42 33 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus (strain Mu50 / ATCC 700699)
B6I093 0.000727 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SE11)
B7M2V7 0.000727 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O8 (strain IAI1)
B7NK49 0.000727 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0TKV9 0.000748 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N8L5 0.000755 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17446 0.000755 42 42 0 47 2 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12)
B1J0W4 0.000755 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XET8 0.000755 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12 / DH10B)
Q1RFM1 0.000762 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain UTI89 / UPEC)
B5Z1R2 0.000762 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6C3 0.000762 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7
B7MCD2 0.000762 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0T7M8 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Shigella flexneri serotype 5b (strain 8401)
B1LIJ9 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SMS-3-5 / SECEC)
Q8FKI7 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZWV6 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O9:H4 (strain HS)
B7L442 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain 55989 / EAEC)
B7UJG6 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZI52 0.000769 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Escherichia coli O139:H28 (strain E24377A / ETEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17250
Feature type CDS
Gene acrR
Product multidrug efflux transporter transcriptional repressor AcrR
Location 20052 - 20699 (strand: -1)
Length 648 (nucleotides) / 215 (amino acids)

Contig

Accession ZDB_378
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2125
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF08361 MAATS-type transcriptional repressor, C-terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03577 TetR/AcrR family transcriptional regulator, acrAB operon repressor - -

Protein Sequence

MARKTKQQAGETRRQIIDAALTAFSEQGVSATSLVDIAKQAGVTRGAIYWHFKNKVDLFTEVCSITDTKIGFIEQEYRAKYPDNPLLVFKKILIYILTSVASDPKMRAILSISFHKCEFTGEMSELITIRQNLYAAEYSRIESFLIESVTLGLLPSTLDLRRAAIMLRGMITGLLENWLFSSESFNISGQAEYLVDGYLDMLMLSKNMQLPPADA

Flanking regions ( +/- flanking 50bp)

CAAACATACACGAATGTATGTAAATTAACTTCAGATGACACAGGCCTTACATGGCACGAAAAACTAAACAACAGGCCGGAGAAACCCGCCGCCAGATTATTGATGCCGCGTTAACCGCCTTCAGTGAGCAGGGCGTGTCTGCGACGTCATTAGTGGATATTGCAAAACAAGCAGGTGTGACCCGTGGTGCGATCTATTGGCACTTCAAAAATAAAGTTGATCTGTTTACTGAAGTCTGTTCGATAACCGATACGAAAATTGGCTTTATTGAACAAGAGTATCGGGCAAAATACCCGGATAATCCACTTTTAGTGTTTAAGAAAATATTAATTTACATTCTGACGTCTGTGGCTTCCGATCCCAAAATGCGGGCTATTCTGAGCATTTCATTTCATAAATGTGAATTTACCGGTGAAATGAGCGAATTAATTACCATCAGACAAAATTTATATGCTGCGGAATACTCAAGAATAGAGTCGTTCCTGATTGAAAGTGTCACACTGGGGCTGCTGCCTTCTACTCTCGACCTGCGTCGTGCCGCCATCATGCTGCGCGGAATGATAACCGGGCTGTTAGAAAACTGGCTCTTTTCCAGCGAGAGTTTTAATATCAGCGGGCAGGCTGAATATTTGGTTGACGGTTATCTGGATATGTTAATGCTCAGTAAAAATATGCAGCTACCGCCGGCAGACGCCTGATTTACATTTTATAACATTAACCTTAAGGATATCATGTATGAAGCCTGTAT