Homologs in group_2125

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15975 FBDBKF_15975 89.8 Morganella morganii S1 acrR multidrug efflux transporter transcriptional repressor AcrR
EHELCC_18580 EHELCC_18580 89.8 Morganella morganii S2 acrR multidrug efflux transporter transcriptional repressor AcrR
NLDBIP_17410 NLDBIP_17410 89.8 Morganella morganii S4 acrR multidrug efflux transporter transcriptional repressor AcrR
LHKJJB_17250 LHKJJB_17250 89.8 Morganella morganii S3 acrR multidrug efflux transporter transcriptional repressor AcrR
HKOGLL_17145 HKOGLL_17145 89.8 Morganella morganii S5 acrR multidrug efflux transporter transcriptional repressor AcrR
PMI_RS00645 PMI_RS00645 61.7 Proteus mirabilis HI4320 acrR multidrug efflux transporter transcriptional repressor AcrR

Distribution of the homologs in the orthogroup group_2125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACT1 1.95e-71 219 50 0 214 3 acrR HTH-type transcriptional regulator AcrR Shigella flexneri
P0ACS9 1.95e-71 219 50 0 214 1 acrR HTH-type transcriptional regulator AcrR Escherichia coli (strain K12)
P0ACT0 1.95e-71 219 50 0 214 3 acrR HTH-type transcriptional regulator AcrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9AIU0 3.31e-45 152 41 2 208 1 ttgR HTH-type transcriptional regulator TtgR Pseudomonas putida (strain DOT-T1E)
Q88N29 3.77e-45 152 41 2 208 3 ttgR Probable HTH-type transcriptional regulator TtgR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KJC4 3.77e-45 152 41 2 208 3 arpR Probable HTH-type transcriptional regulator ArpR Pseudomonas putida
P0C068 8.71e-44 148 40 2 208 3 mepR Probable HTH-type transcriptional regulator MepR Pseudomonas putida
P0ACT2 2.87e-39 137 37 1 208 4 envR Probable acrEF/envCD operon repressor Escherichia coli (strain K12)
P0ACT3 2.87e-39 137 37 1 208 3 envR Probable acrEF/envCD operon repressor Escherichia coli O157:H7
P39897 2.81e-28 108 34 2 201 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
Q8G2M8 5.66e-25 100 30 5 213 1 bepR HTH-type transcriptional repressor BepR Brucella suis biovar 1 (strain 1330)
Q9R9T9 8.49e-21 89 35 4 186 1 srpR HTH-type transcriptional regulator SrpR Pseudomonas putida
Q93PU7 4.03e-17 77 57 0 64 1 ttgW Uncharacterized HTH-type transcriptional regulator TtgW Pseudomonas putida (strain DOT-T1E)
P94548 1.89e-08 55 26 7 196 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
Q2YWD0 1.68e-06 50 43 0 53 4 SAB2452 HTH-type transcriptional regulator SAB2452 Staphylococcus aureus (strain bovine RF122 / ET3-1)
O31500 2.86e-06 50 30 1 76 4 yerO Uncharacterized HTH-type transcriptional regulator YerO Bacillus subtilis (strain 168)
Q6GDM3 5.7e-06 48 43 0 53 4 SAR2658 HTH-type transcriptional regulator SAR2658 Staphylococcus aureus (strain MRSA252)
Q99R60 6.28e-06 48 43 0 53 4 SAV2578 HTH-type transcriptional regulator SAV2578 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q79ZX9 6.28e-06 48 43 0 53 4 MW2498 HTH-type transcriptional regulator MW2498 Staphylococcus aureus (strain MW2)
Q6G696 6.28e-06 48 43 0 53 4 SAS2464 HTH-type transcriptional regulator SAS2464 Staphylococcus aureus (strain MSSA476)
Q7A3C7 6.28e-06 48 43 0 53 4 SA2364 HTH-type transcriptional regulator SA2364 Staphylococcus aureus (strain N315)
Q2FV42 6.41e-06 48 43 0 53 4 SAOUHSC_02897 HTH-type transcriptional regulator SAOUHSC_02897 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HCX3 6.41e-06 48 43 0 53 4 SACOL2593 HTH-type transcriptional regulator SACOL2593 Staphylococcus aureus (strain COL)
Q2FDS9 6.41e-06 48 43 0 53 4 SAUSA300_2515 HTH-type transcriptional regulator SAUSA300_2515 Staphylococcus aureus (strain USA300)
P96701 1.28e-05 47 22 3 178 4 ydgC Uncharacterized HTH-type transcriptional regulator YdgC Bacillus subtilis (strain 168)
Q8GLC6 1.55e-05 47 36 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis
Q5HKQ1 1.63e-05 47 36 0 47 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0R4Z6 2.05e-05 47 35 0 62 1 kstR2 HTH-type transcriptional repressor KstR2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q79ZV4 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MW2)
Q6G609 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MSSA476)
Q6GDD9 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MRSA252)
Q7A352 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain N315)
Q7A2K5 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKF4 2.5e-05 46 36 0 49 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Newman)
Q5HCN2 2.5e-05 46 36 0 49 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain COL)
Q9RQQ0 2.5e-05 46 36 0 49 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain NCTC 8325 / PS 47)
P28815 2.72e-05 46 40 1 62 1 tetC Transposon Tn10 TetC protein Escherichia coli
P95251 2.81e-05 47 39 0 61 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8FTA6 4.59e-05 46 28 2 115 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O31560 0.000169 44 23 8 201 1 yfiR Uncharacterized HTH-type transcriptional regulator YfiR Bacillus subtilis (strain 168)
O53165 0.000198 44 35 1 68 1 Rv1474c HTH-type transcriptional repressor Rv1474c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P51561 0.000284 43 39 0 43 1 tetR Tetracycline repressor protein class H Pasteurella multocida
A8GBX7 0.000304 43 44 0 47 3 betI HTH-type transcriptional regulator BetI Serratia proteamaculans (strain 568)
P32398 0.000307 43 37 0 54 4 yhgD Uncharacterized HTH-type transcriptional regulator YhgD Bacillus subtilis (strain 168)
C6DKY6 0.000327 43 36 0 60 3 betI HTH-type transcriptional regulator BetI Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0S7V2 0.00035 43 36 0 50 1 kstR2 HTH-type transcriptional repressor KstR2 Rhodococcus jostii (strain RHA1)
Q6D6E1 0.000391 43 36 0 60 3 betI HTH-type transcriptional regulator BetI Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B8F853 0.000418 43 28 2 110 3 slmA Nucleoid occlusion factor SlmA Glaesserella parasuis serovar 5 (strain SH0165)
Q66D52 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNP0 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pestis (strain Pestoides F)
Q1CFR9 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGV8 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pestis
B2K8U6 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C930 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKL4 0.000709 42 42 0 47 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
O33453 0.001 42 36 0 57 2 cymR HTH-type transcriptional regulator CymR Pseudomonas putida

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16335
Feature type CDS
Gene acrR
Product multidrug efflux transporter transcriptional repressor AcrR
Location 81656 - 82303 (strand: -1)
Length 648 (nucleotides) / 215 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2125
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF08361 MAATS-type transcriptional repressor, C-terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03577 TetR/AcrR family transcriptional regulator, acrAB operon repressor - -

Protein Sequence

MARKTKQQALETRQQIIDAALIAFSEQGVSSTSLVDIAKQAGVTRGAIYWHFKNKVDLFTEVCAITDTKIGLIEQEYRAKHPDNPLLVFKKILIYILKSAALDPKMRAIMSMSFHKCEFTGEMSELIAIRQNLYAAEYSRIEVYLIESVAQGFLPATLDLRRAAIMLRGMITGLLENWLFSNESFNIVGQAEYLVDGYLDMLMLSNNMQLPPADA

Flanking regions ( +/- flanking 50bp)

CAAACATACACGAATGTATGTAAATTAACTTCAGGTGATACTGACCGTACATGGCACGAAAAACTAAACAACAGGCCCTGGAAACCCGCCAGCAGATTATTGATGCCGCATTAATCGCCTTCAGTGAGCAAGGCGTTTCGTCGACGTCATTAGTGGATATTGCAAAACAAGCGGGTGTCACCCGTGGCGCGATCTATTGGCACTTCAAAAATAAAGTGGATCTGTTTACTGAAGTCTGTGCAATAACTGATACAAAAATTGGATTGATTGAACAAGAGTATCGGGCAAAACACCCGGATAATCCACTTTTAGTGTTTAAGAAAATATTAATTTACATTTTAAAATCAGCCGCATTGGATCCGAAAATGCGGGCCATTATGAGTATGTCATTTCACAAATGTGAATTCACCGGTGAAATGAGTGAGCTTATTGCTATTCGTCAGAATTTATACGCAGCAGAATATTCCAGAATTGAAGTGTATTTGATCGAAAGTGTCGCGCAGGGGTTCCTGCCCGCCACTCTTGACCTGCGCCGTGCCGCCATTATGTTGCGGGGAATGATAACCGGGCTGTTAGAAAACTGGCTCTTTTCCAATGAGAGTTTTAATATTGTCGGACAGGCTGAATATTTGGTTGACGGTTATCTGGATATGCTGATGCTCAGTAATAATATGCAACTACCGCCGGCAGACGCCTGACACCTATTTTCCGAACAATCTGACTCAAGGATCTCATGTATGAAGCCTGT