Homologs in group_361

Help

7 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16080 FBDBKF_16080 100.0 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_16115 EHELCC_16115 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_17225 NLDBIP_17225 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_16695 HKOGLL_16695 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
PMI_RS10995 PMI_RS10995 55.9 Proteus mirabilis HI4320 - TetR/AcrR family transcriptional regulator
PMI_RS13430 PMI_RS13430 25.3 Proteus mirabilis HI4320 - TetR/AcrR family transcriptional regulator
PMI_RS14640 PMI_RS14640 28.5 Proteus mirabilis HI4320 - TetR family transcriptional regulator

Distribution of the homologs in the orthogroup group_361

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_361

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0R4Z6 3.66e-07 52 33 3 103 1 kstR2 HTH-type transcriptional repressor KstR2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9RMY4 3.94e-07 51 28 4 166 4 pXO2-48 Uncharacterized HTH-type transcriptional regulator pXO2-48/BXB0055/GBAA_pXO2_0055 Bacillus anthracis
P42105 1.7e-05 47 27 4 169 1 yxaF Uncharacterized HTH-type transcriptional regulator YxaF Bacillus subtilis (strain 168)
P9WMB9 3.98e-05 46 32 1 95 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 3.98e-05 46 32 1 95 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O34619 0.000128 44 25 6 187 4 lmrA HTH-type transcriptional regulator LmrA Bacillus subtilis (strain 168)
P9WMD5 0.000128 44 28 8 203 1 Rv1255c Uncharacterized HTH-type transcriptional regulator Rv1255c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMD4 0.000128 44 28 8 203 4 MT1294 Uncharacterized HTH-type transcriptional regulator MT1294 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q88N29 0.000772 42 39 0 56 3 ttgR Probable HTH-type transcriptional regulator TtgR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KJC4 0.000772 42 39 0 56 3 arpR Probable HTH-type transcriptional regulator ArpR Pseudomonas putida
Q9AIU0 0.000787 42 39 0 56 1 ttgR HTH-type transcriptional regulator TtgR Pseudomonas putida (strain DOT-T1E)
P95251 0.000805 43 40 1 62 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17145
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 61429 - 62022 (strand: 1)
Length 594 (nucleotides) / 197 (amino acids)
In genomic island -

Contig

Accession ZDB_377
Length 65271 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_361
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Protein Sequence

MKDTDATQTRLSARDRLLEAAGILFYNEGIAATGIDTITKKAGVAKKSLYNNFSSKAELVTTYIRLRHEEWLALYDVRLQQATTPVQRILAVFDAYHDHAEFAYERGFRGCGLLNAAAEFPAGSEERREVCAHKSEVADIIRKNLYQLLPEDTAKAEQLTAHLAFLLEGAIVLAGLEEHGARVLQAAAMAKTMLEAL

Flanking regions ( +/- flanking 50bp)

CTAATAGGTATACTGGTCTACCTATTAATTAAACACAAGAGATTTTCCGGATGAAGGACACCGACGCAACACAGACCCGGCTCAGTGCCAGAGACCGTTTACTGGAAGCCGCAGGCATCTTGTTTTACAACGAGGGCATTGCGGCAACCGGTATTGATACGATCACCAAAAAGGCCGGTGTCGCCAAAAAAAGTCTGTATAACAATTTCAGCTCCAAAGCTGAGTTGGTGACCACTTACATCCGGCTGCGGCATGAAGAATGGCTGGCGTTATATGATGTCCGTCTGCAACAGGCAACAACCCCGGTACAGCGGATCCTGGCGGTATTTGATGCTTATCACGACCATGCTGAGTTTGCCTATGAACGGGGATTCCGGGGATGCGGCCTGCTGAACGCAGCCGCTGAGTTTCCGGCCGGCAGTGAGGAACGTCGCGAAGTGTGTGCTCACAAATCTGAAGTAGCTGATATTATCCGCAAGAACCTTTATCAGTTGCTGCCGGAAGACACCGCGAAAGCAGAGCAACTGACCGCACACCTGGCGTTCTTACTGGAAGGTGCGATTGTACTCGCCGGGCTGGAAGAGCACGGGGCACGGGTATTACAGGCTGCCGCCATGGCAAAAACCATGCTGGAGGCGCTGTGATCCAGACACCCAAAGGCCACTTTGCCGGAATTGCCGTCATTATCCTGGCC