Homologs in group_1698

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11845 FBDBKF_11845 100.0 Morganella morganii S1 crp cAMP-activated global transcriptional regulator CRP
EHELCC_14460 EHELCC_14460 100.0 Morganella morganii S2 crp cAMP-activated global transcriptional regulator CRP
NLDBIP_15555 NLDBIP_15555 100.0 Morganella morganii S4 crp cAMP-activated global transcriptional regulator CRP
HKOGLL_14175 HKOGLL_14175 100.0 Morganella morganii S5 crp cAMP-activated global transcriptional regulator CRP
F4V73_RS14805 F4V73_RS14805 99.5 Morganella psychrotolerans crp cAMP-activated global transcriptional regulator CRP
PMI_RS13930 PMI_RS13930 98.1 Proteus mirabilis HI4320 crp cAMP-activated global transcriptional regulator CRP

Distribution of the homologs in the orthogroup group_1698

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1698

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACK1 4.73e-155 430 98 0 210 3 crp cAMP-activated global transcriptional regulator CRP Shigella flexneri
P0ACJ8 4.73e-155 430 98 0 210 1 crp DNA-binding transcriptional dual regulator CRP Escherichia coli (strain K12)
P0ACJ9 4.73e-155 430 98 0 210 3 crp cAMP-activated global transcriptional regulator CRP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACK0 4.73e-155 430 98 0 210 3 crp cAMP-activated global transcriptional regulator CRP Escherichia coli O157:H7
P0A2T6 1.91e-154 429 97 0 210 1 crp cAMP-activated global transcriptional regulator CRP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T7 1.91e-154 429 97 0 210 1 crp cAMP-activated global transcriptional regulator CRP Klebsiella aerogenes
O05689 2.92e-135 380 86 0 205 3 crp cAMP-activated global transcriptional regulator CRP Pasteurella multocida (strain Pm70)
P29281 2.02e-120 343 76 0 204 1 crp cAMP-activated global transcriptional regulator CRP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P55222 1.73e-97 285 66 2 202 1 vfr cAMP-activated global transcriptional regulator Vfr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3BYB3 4.1e-69 213 45 1 205 3 clp CRP-like protein Clp Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PQ45 4.1e-69 213 45 1 205 1 clp CRP-like protein Clp Xanthomonas axonopodis pv. citri (strain 306)
Q5GV61 1.22e-68 212 44 1 205 3 clp CRP-like protein Clp Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL05 1.22e-68 212 44 1 205 3 clp CRP-like protein Clp Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYD9 1.22e-68 212 44 1 205 3 clp CRP-like protein Clp Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P22260 1.53e-68 212 44 1 205 1 clp CRP-like protein Clp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN01 1.53e-68 212 44 1 205 3 clp CRP-like protein Clp Xanthomonas campestris pv. campestris (strain B100)
Q4UZF6 1.53e-68 212 44 1 205 1 clp CRP-like protein Clp Xanthomonas campestris pv. campestris (strain 8004)
Q79VI7 5.47e-21 90 29 4 204 1 glxR CRP-like cAMP-activated global transcriptional regulator Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P9WMH3 6.85e-20 87 30 4 189 1 crp CRP-like cAMP-activated global transcriptional regulator Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMH2 6.85e-20 87 30 4 189 1 crp CRP-like cAMP-activated global transcriptional regulator Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P33779 6.52e-15 73 26 3 191 4 ntcA Global nitrogen regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A4U7 1.03e-14 73 26 3 190 4 ntcA Global nitrogen regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P0A4U6 1.03e-14 73 26 3 190 1 ntcA Global nitrogen regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P29283 2.63e-13 69 29 6 195 1 ntcA Global nitrogen regulator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5SID7 5.65e-13 68 28 2 191 1 TTHA1437 Cyclic AMP receptor protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5SIL0 1e-10 62 28 3 163 1 TTHA1359 Transcriptional regulator SdrP Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P29284 9e-10 59 27 3 180 4 flp Probable transcriptional regulator flp Lacticaseibacillus casei
P0C6D0 6.26e-09 57 24 2 178 3 fnr Fumarate and nitrate reduction regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F890 6.26e-09 57 24 2 178 3 fnr Fumarate and nitrate reduction regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q53W63 6.42e-09 57 24 1 178 1 TTHB099 Transcriptional regulator LdrP Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q746J8 7.17e-09 56 24 2 178 4 TT_P0055 Transcriptional regulator LdrP Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P46908 8.96e-09 57 27 5 188 2 fnr Anaerobic regulatory protein Bacillus subtilis (strain 168)
Q9CMY2 9e-09 57 23 2 178 3 fnr Anaerobic regulatory protein Pasteurella multocida (strain Pm70)
P45199 1.04e-08 57 24 2 178 3 fnr Anaerobic regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q96UX3 1.19e-08 57 36 3 94 3 pkaR cAMP-dependent protein kinase regulatory subunit Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8ZE82 1.61e-08 56 22 2 179 3 fnr Fumarate and nitrate reduction regulatory protein Yersinia pestis
P46148 3.33e-08 55 23 2 178 3 etrA Electron transport regulator A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O85222 3.99e-08 55 23 2 176 2 anr Transcriptional activator protein Anr Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q9EXQ1 6.68e-08 54 23 2 178 2 fnr Anaerobic regulatory protein Aggregatibacter actinomycetemcomitans
P31320 8.88e-08 55 33 1 93 2 PKAR cAMP-dependent protein kinase regulatory subunit Blastocladiella emersonii
P0A2T8 9.86e-08 54 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T9 9.86e-08 54 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella muenster
P0A9E8 1.04e-07 54 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Shigella flexneri
P0A9E5 1.04e-07 54 22 3 179 1 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli (strain K12)
P0A9E6 1.04e-07 54 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9E7 1.04e-07 54 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Escherichia coli O157:H7
Q9AQ50 1.64e-07 53 22 3 179 3 fnr Fumarate nitrate reduction regulatory protein Klebsiella oxytoca
P23619 2.01e-07 53 23 3 182 4 hlyX Regulatory protein HlyX Actinobacillus pleuropneumoniae
Q8Z787 3.62e-07 52 21 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Salmonella typhi
Q9LA24 4.14e-07 52 22 3 179 3 fnr Fumarate and nitrate reduction regulatory protein Shigella dysenteriae
P47200 4.47e-07 52 23 2 179 4 fnrA Transcriptional activator protein FnrA Stutzerimonas stutzeri
P23926 8.93e-07 51 23 2 176 4 anr Transcriptional activator protein anr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P51007 9.06e-07 51 23 2 192 4 fnrL Transcriptional activator protein FnrL Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9C196 1.76e-06 51 31 3 94 3 pkaR cAMP-dependent protein kinase regulatory subunit Aspergillus niger
P0DV29 3.08e-06 50 28 2 101 1 pycTIR Pycsar effector protein XpPycTIR Xanthomonas perforans
Q1DLC7 3.66e-06 50 28 1 95 3 NTE1 Lysophospholipase NTE1 Coccidioides immitis (strain RS)
Q0CNC7 5.29e-06 50 26 1 102 3 nte1 Lysophospholipase nte1 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A4QVZ8 1.06e-05 49 25 3 147 3 NTE1 Lysophospholipase NTE1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q2UDH2 1.2e-05 48 26 1 101 3 nte1 Lysophospholipase nte1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A1C9L6 1.78e-05 48 25 1 102 3 nte1 Lysophospholipase nte1 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q2H0D3 2.49e-05 48 25 4 148 3 NTE1 Lysophospholipase NTE1 Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q01980 3.58e-05 46 21 3 179 1 aadR Transcriptional activatory protein AadR Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7S8J1 3.7e-05 47 24 3 137 3 nte1 Lysophospholipase nte1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q0UJ42 3.98e-05 47 27 1 97 3 NTE1 Lysophospholipase NTE1 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q0UJ42 0.00045 44 26 4 134 3 NTE1 Lysophospholipase NTE1 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A1D9Y2 5.16e-05 47 24 2 123 3 nte1 Lysophospholipase nte1 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q9PT84 5.59e-05 47 28 2 88 2 KCNH6 Voltage-gated inwardly rectifying potassium channel KCNH6 Gallus gallus
P31319 6.17e-05 46 28 2 102 2 None cAMP-dependent protein kinase regulatory subunit Aplysia californica
Q89NA7 8.02e-05 46 29 3 118 3 glsA1 Glutaminase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q08530 8.74e-05 45 20 3 180 4 btr Transcriptional regulatory protein btr Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A2R350 0.000119 45 26 2 126 3 nte1 Lysophospholipase nte1 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q38998 0.00021 45 32 2 87 1 AKT1 Potassium channel AKT1 Arabidopsis thaliana
Q9C1C2 0.000249 44 29 3 95 3 PKAR cAMP-dependent protein kinase regulatory subunit Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
P26488 0.000277 44 25 2 145 2 fixK Nitrogen fixation regulation protein FixK Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9H252 0.000289 44 28 2 88 1 KCNH6 Voltage-gated inwardly rectifying potassium channel KCNH6 Homo sapiens
Q6GDH1 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain MRSA252)
Q7A381 0.000366 43 21 3 197 1 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain N315)
Q99R06 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YWH5 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IW58 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain JH9)
A6U515 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain JH1)
A7X715 0.000366 43 21 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9TSZ3 0.000419 44 26 2 90 2 KCNH2 Voltage-gated inwardly rectifying potassium channel KCNH2 Canis lupus familiaris
Q03043 0.00042 44 30 5 123 1 for cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B Drosophila melanogaster
Q12809 0.000423 44 26 2 90 1 KCNH2 Voltage-gated inwardly rectifying potassium channel KCNH2 Homo sapiens
A0A0J5WTU0 0.00043 43 27 1 96 1 pycTIR Pycsar effector protein BcPycTIR Burkholderia cepacia
O08962 0.000431 44 26 2 90 1 Kcnh2 Voltage-gated inwardly rectifying potassium channel KCNH2 Rattus norvegicus
Q9TUI4 0.000435 44 26 2 90 2 KCNH2 Voltage-gated inwardly rectifying potassium channel KCNH2 Sus scrofa
O35219 0.000435 44 26 2 90 1 Kcnh2 Voltage-gated inwardly rectifying potassium channel KCNH2 Mus musculus
Q8WNY2 0.000473 44 26 2 90 2 KCNH2 Voltage-gated inwardly rectifying potassium channel KCNH2 Oryctolagus cuniculus
P00515 0.000481 43 31 3 105 1 PRKAR2A cAMP-dependent protein kinase type II-alpha regulatory subunit Bos taurus
O08703 0.00051 43 26 2 90 2 KCNH2 Voltage-gated inwardly rectifying potassium channel KCNH2 (Fragment) Cavia porcellus
O88704 0.000517 43 32 4 87 1 Hcn1 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 Mus musculus
Q9JKB0 0.000526 43 32 4 87 2 Hcn1 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 Rattus norvegicus
O60741 0.00058 43 32 4 87 1 HCN1 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 Homo sapiens
Q9MZS1 0.000585 43 32 4 87 2 HCN1 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 Oryctolagus cuniculus
P32023 0.000601 43 30 5 129 2 for cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 Drosophila melanogaster
Q9NS40 0.000608 43 25 2 90 1 KCNH7 Voltage-gated inwardly rectifying potassium channel KCNH7 Homo sapiens
Q9ER47 0.000619 43 25 2 90 1 Kcnh7 Voltage-gated inwardly rectifying potassium channel KCNH7 Mus musculus
O54852 0.000654 43 25 2 90 1 Kcnh7 Voltage-gated inwardly rectifying potassium channel KCNH7 Rattus norvegicus
P81900 0.00066 43 31 3 94 1 Pka-R2 cAMP-dependent protein kinase type II regulatory subunit Drosophila melanogaster
Q9TV66 0.000709 43 32 4 88 1 HCN4 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 Oryctolagus cuniculus
O54853 0.000808 43 28 2 88 1 Kcnh6 Voltage-gated inwardly rectifying potassium channel KCNH6 Rattus norvegicus
Q9Y3Q4 0.000839 43 32 4 88 1 HCN4 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 Homo sapiens
A8Z5D0 0.000852 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain USA300 / TCH1516)
A6QKC0 0.000852 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain Newman)
Q5HCR6 0.000852 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain COL)
Q2FUY1 0.000852 42 20 3 197 1 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDM8 0.000852 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain USA300)
Q9JKA7 0.00087 43 32 4 88 1 Hcn4 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 Rattus norvegicus
O70507 0.000878 43 32 4 88 1 Hcn4 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 Mus musculus
Q4WA15 0.001 43 24 1 102 3 nte1 Lysophospholipase nte1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8NUK9 0.001 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain MW2)
Q6G643 0.001 42 20 3 197 3 arcR HTH-type transcriptional regulator ArcR Staphylococcus aureus (strain MSSA476)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15055
Feature type CDS
Gene crp
Product cAMP-activated global transcriptional regulator CRP
Location 19552 - 20184 (strand: 1)
Length 633 (nucleotides) / 210 (amino acids)

Contig

Accession ZDB_373
Length 137108 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1698
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00027 Cyclic nucleotide-binding domain
PF13545 Crp-like helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0664 Signal transduction mechanisms (T) T cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10914 CRP/FNR family transcriptional regulator, cyclic AMP receptor protein Two-component system
Quorum sensing
Biofilm formation - Pseudomonas aeruginosa
Biofilm formation - Escherichia coli
Biofilm formation - Vibrio cholerae		 -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042734 cAMP-regulatory protein VF0082 Adherence

Protein Sequence

MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERTAWVRAKSACEVAEISYKKFRQLIQVNPDILMRLSAQMASRLQTTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR

Flanking regions ( +/- flanking 50bp)

GCAGAGCGTAAACAACGGTTTGCAATAACTAACAACAGAGGATAACGCGAATGGTTCTCGGCAAGCCACAAACAGACCCCACGCTTGAATGGTTTTTGTCTCACTGCCATATCCACAAATATCCATCCAAAAGCACGCTTATTCATCAGGGCGAAAAGGCAGAAACACTCTACTATATTGTAAAAGGTTCTGTTGCGGTGCTGATCAAAGATGAAGAAGGCAAAGAGATGATTTTATCCTATCTCAACCAGGGTGATTTCATCGGTGAACTCGGATTATTTGAGGAAGGACAGGAACGTACAGCGTGGGTACGGGCAAAAAGCGCCTGCGAAGTTGCAGAAATCTCGTACAAAAAGTTCCGCCAGCTTATCCAGGTTAACCCGGATATCCTTATGCGCCTTTCCGCGCAGATGGCAAGCCGCCTGCAAACCACATCAGAAAAGGTCGGAAACCTTGCATTCCTTGATGTGACAGGCCGCATCGCCCAGACATTACTGAACCTGGCAAAACAGCCGGATGCAATGACTCATCCGGACGGCATGCAAATCAAAATTACCCGTCAGGAAATCGGCCAGATTGTGGGATGTTCCCGCGAAACCGTCGGTCGTATTCTGAAGATGCTGGAAGATCAAAACCTGATCTCCGCACACGGTAAAACTATCGTGGTATACGGCACCCGTTAATCCGGACCGCCCTTATCACCAAAACAGGCGCATCTGCGCCTGTTTTTTTG