Homologs in group_1631

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10330 FBDBKF_10330 100.0 Morganella morganii S1 uspA universal stress protein UspA
EHELCC_14665 EHELCC_14665 100.0 Morganella morganii S2 uspA universal stress protein UspA
NLDBIP_14495 NLDBIP_14495 100.0 Morganella morganii S4 uspA universal stress protein UspA
HKOGLL_13470 HKOGLL_13470 100.0 Morganella morganii S5 uspA universal stress protein UspA
F4V73_RS14030 F4V73_RS14030 97.9 Morganella psychrotolerans uspA universal stress protein UspA
PMI_RS14880 PMI_RS14880 91.0 Proteus mirabilis HI4320 uspA universal stress protein UspA

Distribution of the homologs in the orthogroup group_1631

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1631

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZA49 3.94e-90 261 84 0 145 3 uspA Universal stress protein A Yersinia pestis
P0AED4 3.6e-89 258 86 0 143 3 uspA Universal stress protein A Shigella sonnei
P0AED3 3.6e-89 258 86 0 143 3 uspA Universal stress protein A Shigella flexneri
P0AED0 3.6e-89 258 86 0 143 1 uspA Universal stress protein A Escherichia coli (strain K12)
P0AED1 3.6e-89 258 86 0 143 3 uspA Universal stress protein A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AED2 3.6e-89 258 86 0 143 3 uspA Universal stress protein A Escherichia coli O157:H7
Q8ZLD7 5.71e-89 258 85 0 143 3 uspA Universal stress protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z268 2.49e-88 256 84 0 143 3 uspA Universal stress protein A Salmonella typhi
P60004 4.44e-88 256 86 0 143 3 uspA Universal stress protein A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9CLE9 2.75e-66 200 67 0 140 3 uspA Universal stress protein A homolog Pasteurella multocida (strain Pm70)
P44880 4.81e-66 200 67 0 140 1 uspA Universal stress protein A homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VLK1 4.08e-54 169 57 0 140 3 uspA Universal stress protein A homolog Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q89A25 1.83e-43 142 47 1 140 3 uspA Universal stress protein A Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9RM66 2.56e-31 112 41 2 143 3 uspC Universal stress protein C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X560 3.3e-28 104 37 2 143 3 uspC Universal stress protein C Escherichia coli O157:H7
Q8FGN7 1.51e-27 102 37 2 143 3 uspC Universal stress protein C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67089 5.49e-27 101 36 0 141 3 uspD Universal stress protein D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67090 5.49e-27 101 36 0 141 3 uspD Universal stress protein D Escherichia coli O157:H7
P0AAB9 5.86e-27 100 36 0 141 3 uspD Universal stress protein D Shigella flexneri
P0AAB8 5.86e-27 100 36 0 141 2 uspD Universal stress protein D Escherichia coli (strain K12)
P46888 3.95e-26 99 36 2 143 2 uspC Universal stress protein C Escherichia coli (strain K12)
Q8Z5U4 5.03e-26 98 41 2 125 3 uspC Universal stress protein C Salmonella typhi
Q83AC1 2.83e-11 60 29 4 147 3 uspA1 Universal stress protein A homolog 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q2FXL6 0.000218 42 32 0 78 3 SAOUHSC_01819 Putative universal stress protein SAOUHSC_01819 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GFZ7 0.000218 42 32 0 78 3 SAR1788 Putative universal stress protein SAR1788 Staphylococcus aureus (strain MRSA252)
Q5HF64 0.000218 42 32 0 78 3 SACOL1759 Putative universal stress protein SACOL1759 Staphylococcus aureus (strain COL)
Q99TF3 0.000218 42 32 0 78 3 SAV1710 Putative universal stress protein SAV1710 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FG28 0.000218 42 32 0 78 3 SAUSA300_1656 Putative universal stress protein SAUSA300_1656 Staphylococcus aureus (strain USA300)
Q7A0N0 0.000218 42 32 0 78 3 MW1653 Putative universal stress protein MW1653 Staphylococcus aureus (strain MW2)
Q6G8L7 0.000218 42 32 0 78 3 SAS1637 Putative universal stress protein SAS1637 Staphylococcus aureus (strain MSSA476)
Q2YTD0 0.000218 42 32 0 78 3 SAB1569 Putative universal stress protein SAB1569 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A551 0.000218 42 32 0 78 1 SA1532 Putative universal stress protein SA1532 Staphylococcus aureus (strain N315)
Q49YE0 0.000438 41 27 1 111 3 SSP1056 Putative universal stress protein SSP1056 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14850
Feature type CDS
Gene uspA
Product universal stress protein UspA
Location 120680 - 121117 (strand: 1)
Length 438 (nucleotides) / 145 (amino acids)
In genomic island -

Contig

Accession ZDB_372
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1631
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00582 Universal stress protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0589 Signal transduction mechanisms (T) T Nucleotide-binding universal stress protein, UspA family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06149 universal stress protein A - -

Protein Sequence

MAYKHILVAVDLSPESEVLVSKAVSMAKPYNAKVSLIHVDVNYSDLYTGLIDVNLGDMQQRITEETSNSLKNLAKNSGYEIQEMLSGSGDLGQVLVDAIRKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDDDNA

Flanking regions ( +/- flanking 50bp)

CGGCGCAAGCCCTGCCAACCCCTTAACCTTTTGAACGGAAGGAGTTTCTTATGGCATATAAACATATTCTGGTCGCAGTCGATCTTTCGCCTGAAAGTGAAGTGTTAGTAAGCAAAGCAGTTTCTATGGCAAAACCTTACAACGCCAAAGTTTCTCTGATCCACGTTGATGTCAATTACTCTGACTTATACACCGGACTTATCGATGTTAACCTGGGTGATATGCAGCAGCGCATTACTGAAGAAACCAGTAATTCACTGAAAAACCTGGCGAAAAATTCCGGTTATGAGATTCAGGAAATGCTCAGCGGCAGCGGTGATCTCGGCCAGGTATTAGTCGATGCCATCAGAAAATATGATATGGACCTGGTTGTCTGCGGACACCACCAGGATTTCTGGAGCAAACTGATGTCTTCCGCCCGTCAGCTGATTAACACCGTTCATGTCGATATGTTAATTGTTCCGCTGCGGGATGATGATAACGCATAATCCTCTGCTGAAAAATTATTCATATAAAATGCCTGCTTATGCAGGCATTT