Homologs in group_1495

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09650 FBDBKF_09650 100.0 Morganella morganii S1 modB molybdate ABC transporter permease subunit
EHELCC_04450 EHELCC_04450 100.0 Morganella morganii S2 modB molybdate ABC transporter permease subunit
NLDBIP_04450 NLDBIP_04450 100.0 Morganella morganii S4 modB molybdate ABC transporter permease subunit
HKOGLL_12355 HKOGLL_12355 100.0 Morganella morganii S5 modB molybdate ABC transporter permease subunit
F4V73_RS00690 F4V73_RS00690 96.1 Morganella psychrotolerans modB molybdate ABC transporter permease subunit
PMI_RS02945 PMI_RS02945 89.1 Proteus mirabilis HI4320 modB molybdate ABC transporter permease subunit

Distribution of the homologs in the orthogroup group_1495

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1495

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AF01 5.3e-111 320 77 0 227 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 5.3e-111 320 77 0 227 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
P45322 2.18e-97 286 67 0 222 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16701 8.69e-35 128 37 1 201 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
O32209 9.27e-35 126 39 1 197 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
P41032 2.31e-34 127 37 1 201 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A2CI71 3.23e-33 124 38 2 187 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9TKU8 4.19e-32 121 36 3 204 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q2EEX6 8.23e-32 120 34 2 199 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P37731 2.57e-31 117 35 2 189 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
Q9MUL9 3.78e-31 118 34 2 202 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
P26246 1.61e-30 117 35 3 200 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
O30143 3.94e-30 115 36 1 161 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P56343 5.11e-30 115 35 1 181 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
P74547 4.19e-29 113 36 1 174 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AEB0 1.42e-28 112 36 5 223 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 1.42e-28 112 36 5 223 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32RF7 2.8e-28 111 35 1 162 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q08382 3.03e-28 109 36 2 176 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
P18795 4.13e-28 110 34 3 191 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
Q9TJR4 4.98e-28 109 30 2 212 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q8RVC7 1.88e-27 111 35 3 220 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
P27370 2.29e-27 108 38 1 175 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q6QJE2 1.25e-26 108 37 1 187 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
Q01895 1.17e-25 104 32 4 233 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P27367 4.21e-25 102 36 2 202 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9V2C1 1.92e-24 100 36 2 174 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
Q85AI0 2.79e-24 100 33 3 209 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
Q5JEB3 3.14e-24 99 32 5 224 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q58763 1.13e-23 98 32 6 228 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
D4GQ17 1.96e-23 98 38 5 197 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P9WG13 5.44e-23 96 45 1 177 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 5.44e-23 96 45 1 177 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 5.44e-23 96 45 1 177 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O57893 5.95e-23 96 34 2 174 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U4K4 1.27e-22 95 30 4 213 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P96064 2.36e-15 76 29 6 227 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 2.52e-15 76 29 6 227 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SD7 5.81e-15 75 29 6 227 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
Q8Z8W9 1.87e-14 73 29 6 227 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
P0AFK5 1.7e-12 68 29 3 185 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 1.7e-12 68 29 3 185 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
Q83RR7 3.77e-12 67 28 6 229 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P0AFK6 5.17e-12 67 28 6 226 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 5.17e-12 67 28 6 226 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 5.17e-12 67 28 6 226 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q44123 9.74e-12 67 27 5 209 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q44123 0.000164 45 23 4 225 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
P0AFL1 2.63e-11 65 34 7 195 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 2.63e-11 65 34 7 195 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0CL49 4.07e-11 64 27 3 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 4.07e-11 64 27 3 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 4.07e-11 64 27 3 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
P45169 4.79e-11 64 28 4 219 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57341 6.05e-11 65 27 5 208 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57341 0.000541 44 23 2 177 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31135 1.44e-09 60 30 3 162 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
Q8ZRV1 3.42e-08 56 28 4 221 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45170 4.65e-08 55 38 1 77 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P47290 1.01e-07 54 23 2 178 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P55602 1.38e-07 54 27 3 180 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P31549 2.92e-07 53 28 4 221 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
P77156 1.41e-06 51 27 6 173 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
Q5PFQ5 1.99e-06 50 28 8 233 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8X0 2.1e-06 50 28 8 233 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
P75057 2.26e-06 50 23 2 175 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q57SD8 2.49e-06 50 28 8 231 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
Q57380 4.06e-06 48 30 0 79 5 HI_1475 Putative uncharacterized protein HI_1475 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0P886 5.74e-06 49 23 3 218 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P71338 7.83e-06 49 30 2 95 3 fbpB2 Fe(3+)-transport system permease protein FbpB 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71338 0.001 43 27 2 139 3 fbpB2 Fe(3+)-transport system permease protein FbpB 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O07011 1.03e-05 48 25 3 182 1 ganQ Galactooligosaccharides transport system permease protein GanQ Bacillus subtilis (strain 168)
P46340 2.36e-05 47 38 0 73 3 yqgI Probable ABC transporter permease protein YqgI Bacillus subtilis (strain 168)
Q8Z1U3 2.44e-05 47 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Salmonella typhi
P68186 2.61e-05 47 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Shigella flexneri
P68183 2.61e-05 47 24 5 209 1 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli (strain K12)
P68184 2.61e-05 47 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P68185 2.61e-05 47 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O157:H7
P26468 2.89e-05 47 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P96065 2.96e-05 47 28 8 233 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55452 3.38e-05 47 26 3 150 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q93KD5 6.12e-05 46 26 3 145 1 tupB Tungstate uptake system permease protein TupB Peptoclostridium acidaminophilum
P9WG01 6.27e-05 46 26 2 150 1 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG00 6.27e-05 46 26 2 150 3 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P18814 9.19e-05 46 24 5 209 3 malG Maltose/maltodextrin transport system permease protein MalG Klebsiella aerogenes
O58760 0.0001 45 27 3 146 3 PH1036 Probable ABC transporter permease protein PH1036 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q87GB8 0.000138 45 24 5 207 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KL07 0.000149 45 25 6 211 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MFC1 0.000249 44 26 6 192 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain YJ016)
Q8D3U7 0.000249 44 26 6 192 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain CMCP6)
Q74RF8 0.000367 44 25 5 207 3 malG Maltose/maltodextrin transport system permease protein MalG Yersinia pestis
O32154 0.000546 43 28 4 153 3 yurM Probable ABC transporter permease protein YurM Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14180
Feature type CDS
Gene modB
Product molybdate ABC transporter permease subunit
Location 114042 - 114737 (strand: 1)
Length 696 (nucleotides) / 231 (amino acids)

Contig

Accession ZDB_371
Length 143607 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1495
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4149 Inorganic ion transport and metabolism (P) P ABC-type molybdate transport system, permease component ModB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02018 molybdate transport system permease protein ABC transporters -

Protein Sequence

MLNEYEWQAVILSLKVSTVAVAASLPFGILMAWVLVRCRFPGKSLLDSLIHLPLVLPPVVVGYLLLISMGRKGIIGEWLYNWFGFSFTFSWRGAALAAAVVAFPLMVRAIRLALEAVDMRLEQAARTLGASPLRVFFTITLPLSLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTIPLAMYSLLETPGAEMDAARLCIIAIVLALASLLASEWLTRWGRKRLGVAAC

Flanking regions ( +/- flanking 50bp)

AAACGTTACGGTTTCAGCCCTCTGTAATAAGTAAGGACTAACAGACAGCGATGTTGAATGAGTATGAATGGCAGGCGGTCATCCTCAGCCTGAAAGTATCAACGGTCGCCGTGGCAGCCAGTCTGCCGTTCGGCATACTGATGGCATGGGTACTGGTGCGCTGCCGTTTTCCGGGCAAGTCGCTGCTGGACAGTCTTATCCACTTACCGCTGGTGTTACCGCCGGTGGTAGTGGGTTATCTGCTGCTGATCAGCATGGGGCGCAAAGGCATTATCGGTGAGTGGCTCTATAACTGGTTCGGCTTCAGTTTTACCTTCAGCTGGCGCGGTGCCGCGCTGGCTGCGGCTGTGGTGGCTTTTCCGCTGATGGTGAGGGCTATCCGCCTGGCGCTGGAAGCGGTGGATATGCGCCTGGAGCAGGCGGCACGGACACTCGGGGCTTCCCCGCTGCGGGTCTTTTTCACCATCACACTGCCGCTGTCGCTGCCGGGTATTATTGTCGGTACTGTGCTGGCATTTGCCCGTTCGCTGGGGGAATTCGGCGCGACAATCACCTTTGTTTCCAATATCCCGGGGGAAACCCGGACTATCCCGCTGGCCATGTACTCCCTGCTTGAAACGCCGGGGGCGGAAATGGACGCAGCGCGGCTCTGTATTATCGCCATTGTTCTGGCACTGGCTTCACTGCTGGCCTCGGAATGGCTGACCCGCTGGGGGCGCAAACGCCTGGGGGTTGCCGCATGTTAGTGCTTGATTTTGAACAGCAGCTCGGTGATTTATCCATGGTGATCAATACC