Homologs in group_1333

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08245 FBDBKF_08245 100.0 Morganella morganii S1 rfbA glucose-1-phosphate thymidylyltransferase RfbA
EHELCC_13280 EHELCC_13280 100.0 Morganella morganii S2 rfbA glucose-1-phosphate thymidylyltransferase RfbA
NLDBIP_13620 NLDBIP_13620 100.0 Morganella morganii S4 rfbA glucose-1-phosphate thymidylyltransferase RfbA
HKOGLL_12095 HKOGLL_12095 100.0 Morganella morganii S5 rfbA glucose-1-phosphate thymidylyltransferase RfbA
F4V73_RS18795 F4V73_RS18795 98.6 Morganella psychrotolerans rfbA glucose-1-phosphate thymidylyltransferase RfbA
PMI_RS16505 PMI_RS16505 84.6 Proteus mirabilis HI4320 rfbA glucose-1-phosphate thymidylyltransferase RfbA

Distribution of the homologs in the orthogroup group_1333

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1333

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P61888 0.0 508 83 0 293 3 rffH Glucose-1-phosphate thymidylyltransferase 2 Shigella flexneri
P61887 0.0 508 83 0 293 1 rffH Glucose-1-phosphate thymidylyltransferase 2 Escherichia coli (strain K12)
P55257 1.34e-163 459 74 0 285 3 rmlA Glucose-1-phosphate thymidylyltransferase Yersinia enterocolitica
P55255 7.95e-160 449 74 0 286 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P57040 1.1e-159 449 73 0 286 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P37762 1.33e-153 433 71 0 286 3 rmlA Glucose-1-phosphate thymidylyltransferase Neisseria gonorrhoeae
P95778 1.02e-147 418 67 0 286 3 rmlA Glucose-1-phosphate thymidylyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P55254 7.84e-146 414 66 0 285 3 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella anatum
P37779 7.93e-143 406 66 0 285 3 rfbA Glucose-1-phosphate thymidylyltransferase 1 Shigella flexneri
P26393 8.47e-143 406 65 0 285 1 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37744 1.87e-142 405 66 0 284 1 rfbA Glucose-1-phosphate thymidylyltransferase 1 Escherichia coli (strain K12)
P55253 4.72e-141 402 65 1 286 1 rmlA Glucose-1-phosphate thymidylyltransferase Escherichia coli
P55464 1.22e-129 372 63 0 285 3 rmlA Probable glucose-1-phosphate thymidylyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A0QPF9 6.46e-129 371 60 1 286 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WH13 3.19e-128 369 61 1 286 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH12 3.19e-128 369 61 1 286 3 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0C7J4 7.93e-128 368 61 0 284 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVK9 7.93e-128 368 61 0 284 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q9L9E6 3.29e-120 349 56 1 286 3 novV Glucose-1-phosphate thymidylyltransferase Streptomyces niveus
Q9ZAE7 2.08e-106 314 53 1 285 3 acbA Glucose-1-phosphate thymidylyltransferase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
P39629 1.35e-64 206 43 5 249 1 rmlA Glucose-1-phosphate thymidylyltransferase Bacillus subtilis (strain 168)
Q9RR29 2.61e-48 167 38 4 246 3 oleS Glucose-1-phosphate thymidylyltransferase Streptomyces antibioticus
P08075 1.26e-43 155 36 5 246 3 strD Glucose-1-phosphate thymidylyltransferase Streptomyces griseus
D4GU70 5.85e-43 153 35 4 270 3 agl11 Low-salt glycan biosynthesis nucleotidyltransferase Agl11 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q58501 2.34e-21 96 30 6 246 1 glmU Bifunctional protein GlmU Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6UUQ4 7.48e-21 94 27 6 238 3 Maeo_0642 Bifunctional protein GlmU Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q975F9 3.18e-20 93 29 7 237 1 STK_04520 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9I291 8.55e-18 84 26 9 273 1 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
D4GYH1 8.73e-18 84 27 6 215 1 aglF UTP--glucose-1-phosphate uridylyltransferase AglF Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q58730 1.08e-17 84 25 8 265 3 MJ1334 Putative UTP--glucose-1-phosphate uridylyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q4I1Y5 1.66e-17 85 27 7 255 3 MPG1 Mannose-1-phosphate guanyltransferase Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P47691 1.92e-17 84 25 9 270 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q70SJ2 2.41e-17 84 26 6 259 1 MPG1 Mannose-1-phosphate guanyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A4FX98 2.78e-17 84 30 8 260 3 MmarC5_0513 Bifunctional protein GlmU Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
O93827 3.52e-17 84 26 6 258 1 MPG1 Mannose-1-phosphate guanyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
A6VG23 5.03e-17 84 30 8 236 3 MmarC7_0329 Bifunctional protein GlmU Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q752H4 5.09e-16 80 26 9 257 3 MPG1 Mannose-1-phosphate guanyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q6LYB5 5.78e-16 80 30 7 236 3 MMP1076 Bifunctional protein GlmU Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q6DBU5 5.84e-16 80 27 7 250 1 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Danio rerio
Q6CCU3 8.04e-16 80 24 6 247 3 MPG1 Mannose-1-phosphate guanyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q6FRY2 8.24e-16 80 25 8 258 3 MPG1 Mannose-1-phosphate guanyltransferase 2 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q6BN12 1.2e-15 79 26 10 264 3 MPG1 Mannose-1-phosphate guanyltransferase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
O74624 1.25e-15 79 26 7 255 1 mpg1 Mannose-1-phosphate guanyltransferase Hypocrea jecorina
P41940 1.81e-15 79 25 7 254 1 PSA1 Mannose-1-phosphate guanyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9Y725 5.46e-15 77 24 7 275 1 MPG1 Mannose-1-phosphate guanyltransferase 1 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P75124 5.56e-15 77 26 10 270 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q4A122 5.74e-15 76 27 8 229 3 gtaB1 UTP--glucose-1-phosphate uridylyltransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6Z9A3 1.04e-14 77 27 8 258 2 Os08g0237200 Probable mannose-1-phosphate guanylyltransferase 3 Oryza sativa subsp. japonica
A2VD83 1.11e-14 76 27 10 253 2 gmppb-b Mannose-1-phosphate guanyltransferase beta-B Xenopus laevis
Q68EQ1 1.22e-14 76 27 9 248 2 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Xenopus tropicalis
Q68EY9 1.37e-14 76 26 9 252 2 gmppb-a Mannose-1-phosphate guanyltransferase beta-A Xenopus laevis
Q9F664 1.43e-14 75 25 10 274 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q84JH5 1.61e-14 76 27 8 258 2 Os03g0268400 Probable mannose-1-phosphate guanylyltransferase 1 Oryza sativa subsp. japonica
Q49VP4 1.66e-14 75 27 12 278 3 gtaB2 UTP--glucose-1-phosphate uridylyltransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q54800 2.67e-14 75 25 6 252 3 cap3C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae
Q941T9 3.16e-14 75 27 8 258 2 Os01g0847200 Probable mannose-1-phosphate guanylyltransferase 2 Oryza sativa subsp. japonica
Q9P8N0 3.22e-14 75 27 4 194 3 MPG1 Mannose-1-phosphate guanyltransferase Pichia angusta
Q7RVR8 3.41e-14 75 27 8 256 3 mpg-1 Mannose-1-phosphate guanyltransferase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O31822 3.43e-14 74 27 10 271 1 yngB UTP--glucose-1-phosphate uridylyltransferase YngB Bacillus subtilis (strain 168)
Q61S97 3.71e-14 75 25 5 254 3 tag-335 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Caenorhabditis briggsae
Q7JZB4 4e-14 75 23 4 251 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila melanogaster
Q05852 5.4e-14 73 26 12 299 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q295Y7 9.05e-14 74 23 4 251 3 GA10892 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila pseudoobscura pseudoobscura
Q6GDU6 1.16e-13 73 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MRSA252)
P0CO20 1.24e-13 73 28 9 233 2 MPG1 Mannose-1-phosphate guanyltransferase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CO21 1.24e-13 73 28 9 233 3 MPG1 Mannose-1-phosphate guanyltransferase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q7A3J9 1.29e-13 72 26 7 232 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain N315)
Q99RD4 1.29e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD54 1.29e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain COL)
Q2G1T6 1.29e-13 72 26 7 232 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE05 1.29e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain USA300)
Q59633 1.32e-13 72 25 9 268 3 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa
Q8NUU9 1.42e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MW2)
Q6G6H5 1.42e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MSSA476)
Q030T6 1.7e-13 73 28 10 267 3 glgC Glucose-1-phosphate adenylyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q4L8Y7 1.83e-13 72 27 10 235 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q9CHN1 2.9e-13 72 28 10 267 3 glgC Glucose-1-phosphate adenylyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P42407 3.01e-13 71 27 9 225 3 ytdA Putative UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q2YW63 3.14e-13 72 26 7 232 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4U3E8 4.23e-13 72 26 7 257 2 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2UJU5 5.02e-13 72 26 7 257 3 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
L7N6A5 5.08e-13 72 24 4 238 1 manB Mannose-1-phosphate guanylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A3QMC8 6.94e-13 71 25 1 183 3 tag-335 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Caenorhabditis elegans
Q8CR67 7.07e-13 70 26 8 229 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLD1 7.07e-13 70 26 8 229 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q54K39 8.37e-13 71 25 5 248 2 gmppB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Dictyostelium discoideum
A6UP85 8.58e-13 71 27 7 243 3 Mevan_0399 Bifunctional protein GlmU Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A2RMB7 8.62e-13 71 28 10 267 3 glgC Glucose-1-phosphate adenylyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
P0C5I2 1.32e-12 70 25 7 251 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Sus scrofa
Q9Y5P6 1.61e-12 70 25 7 251 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Homo sapiens
Q5B1J4 2.75e-12 69 26 7 257 3 mpg1 Mannose-1-phosphate guanyltransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P44878 6.79e-12 68 25 8 248 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C0MH79 7.25e-12 68 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus equi subsp. zooepidemicus (strain H70)
Q1WSM9 7.69e-12 68 28 10 266 3 glgC Glucose-1-phosphate adenylyltransferase Ligilactobacillus salivarius (strain UCC118)
Q036S8 8.6e-12 68 28 8 253 3 glgC Glucose-1-phosphate adenylyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W9A3 8.6e-12 68 28 8 253 3 glgC Glucose-1-phosphate adenylyltransferase Lacticaseibacillus casei (strain BL23)
Q8BTZ7 8.89e-12 68 24 7 251 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Mus musculus
Q5FL67 9.57e-12 68 28 10 268 3 glgC Glucose-1-phosphate adenylyltransferase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
O74484 1.04e-11 68 24 6 249 2 mpg1 Mannose-1-phosphate guanyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9M2S0 1.04e-11 68 25 8 259 2 At3g55590 Probable mannose-1-phosphate guanylyltransferase 2 Arabidopsis thaliana
Q0SWS5 2.22e-11 67 27 10 252 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium perfringens (strain SM101 / Type A)
B9DRS6 2.5e-11 67 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
P0C0I8 3.36e-11 66 25 7 231 3 hasC UTP--glucose-1-phosphate uridylyltransferase Streptococcus pyogenes
Q8NKW9 3.36e-11 66 25 7 231 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q2YDJ9 3.85e-11 66 24 7 251 2 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Bos taurus
Q8XP97 4.43e-11 66 27 10 256 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium perfringens (strain 13 / Type A)
A3CM02 5.68e-11 65 27 11 259 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus sanguinis (strain SK36)
Q5X9A7 5.77e-11 65 25 7 231 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG71 5.77e-11 65 25 7 231 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG70 5.77e-11 65 25 7 231 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q890J0 6.16e-11 65 28 10 266 3 glgC Glucose-1-phosphate adenylyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A8AYH2 6.29e-11 65 29 10 258 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8DPS5 6.9e-11 65 27 10 256 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04KG7 6.9e-11 65 27 10 256 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P0DG73 9.1e-11 64 25 8 233 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P67070 9.1e-11 64 25 8 233 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DG72 9.1e-11 64 25 8 233 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67068 9.1e-11 64 25 8 233 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M1
Q5XE04 9.1e-11 64 25 8 233 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
C1CRM1 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CKI5 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain P1031)
C1CEA8 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain JJA)
Q97QS7 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZPW3 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IBQ8 9.37e-11 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
C1C7B5 1.07e-10 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain 70585)
B5E4N4 1.1e-10 65 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
B2IPY6 1.34e-10 64 27 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain CGSP14)
P33696 1.54e-10 64 25 6 228 3 exoN UTP--glucose-1-phosphate uridylyltransferase Rhizobium meliloti (strain 1021)
Q8DT53 1.58e-10 64 28 11 259 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q0P8J1 2.25e-10 62 31 8 192 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8E080 2.42e-10 63 28 11 259 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1K4 2.42e-10 63 28 11 259 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8E5V7 2.68e-10 63 28 11 259 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus agalactiae serotype III (strain NEM316)
P74285 3.63e-10 63 28 9 202 1 cugP UTP--glucose-1-phosphate uridylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0C0I9 4.25e-10 62 24 7 231 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M1
P0A2K7 4.85e-10 62 24 9 236 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K8 4.85e-10 62 24 9 236 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhi
P58313 7.16e-10 62 24 6 234 3 cap4C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q48447 8.19e-10 62 23 8 236 3 galF UTP--glucose-1-phosphate uridylyltransferase Klebsiella pneumoniae
P37820 8.84e-10 62 29 5 185 3 mpg1 Putative mannose-1-phosphate guanyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P0AEP6 1.26e-09 61 23 7 243 1 galU UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0AEP3 1.26e-09 61 23 7 243 1 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AEP4 1.26e-09 61 23 7 243 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEP5 1.26e-09 61 23 7 243 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
Q65FS5 1.45e-09 61 28 11 253 3 glgC Glucose-1-phosphate adenylyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0AAB6 1.74e-09 61 24 8 236 1 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AAB7 1.74e-09 61 24 8 236 3 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
O22287 2.72e-09 60 26 4 187 1 CYT1 Mannose-1-phosphate guanylyltransferase 1 Arabidopsis thaliana
Q88QT2 4.44e-09 58 34 1 108 1 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P37776 5.29e-09 59 24 8 236 3 galF UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
A6M331 1.31e-08 58 26 9 251 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B2V046 2.4e-08 58 27 10 254 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
Q9JXY0 3.45e-08 56 24 10 253 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B2TR25 3.49e-08 57 27 10 254 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
B1YK68 5.71e-08 57 27 11 258 3 glgC Glucose-1-phosphate adenylyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0HST8 1.36e-07 55 26 8 267 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella sp. (strain MR-7)
Q0HGJ1 1.36e-07 55 26 8 267 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella sp. (strain MR-4)
Q8DPI6 2.31e-07 54 23 6 180 1 licC Choline-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0KZD8 2.96e-07 54 29 5 182 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella sp. (strain ANA-3)
Q6KHP5 5.11e-07 53 25 5 198 3 glgC Glucose-1-phosphate adenylyltransferase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P80361 7.02e-07 53 49 0 51 2 eif-2Bgamma Translation initiation factor eIF2B subunit gamma Caenorhabditis elegans
H2K888 1.04e-06 53 25 8 208 1 valB Valienol-1-phosphate guanylyltransferase Streptomyces hygroscopicus subsp. jinggangensis (strain 5008)
Q15JG4 1.14e-06 52 25 8 208 1 vldB Valienol-1-phosphate guanylyltransferase Streptomyces hygroscopicus subsp. limoneus
A5PJI7 1.36e-06 52 38 0 55 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Bos taurus
P70541 1.91e-06 52 36 0 55 2 Eif2b3 Translation initiation factor eIF2B subunit gamma Rattus norvegicus
C4Z4L8 2.22e-06 52 26 8 252 3 glgC Glucose-1-phosphate adenylyltransferase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
A9KTJ4 2.23e-06 52 25 8 267 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella baltica (strain OS195)
Q9AGY6 2.81e-06 50 26 4 167 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Aneurinibacillus thermoaerophilus
Q9NR50 3e-06 52 37 0 53 1 EIF2B3 Translation initiation factor eIF2B subunit gamma Homo sapiens
Q18A75 4.35e-06 51 26 11 256 3 glgC Glucose-1-phosphate adenylyltransferase Clostridioides difficile (strain 630)
A3D289 4.64e-06 51 25 9 263 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WKY5 6.03e-06 50 25 8 267 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella baltica (strain OS185)
B8EAW7 6.03e-06 50 25 8 267 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella baltica (strain OS223)
Q97GX8 6.12e-06 50 26 7 192 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8ET56 7.67e-06 50 26 13 276 3 glgC Glucose-1-phosphate adenylyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0Q3I7 9.14e-06 50 24 6 206 3 glgC Glucose-1-phosphate adenylyltransferase Clostridium novyi (strain NT)
P30522 9.31e-06 49 25 6 192 3 glgC Glucose-1-phosphate adenylyltransferase (Fragment) Bacillus caldolyticus
Q4R6T3 9.96e-06 50 37 0 53 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Macaca fascicularis
C5BQ92 1.35e-05 49 29 7 182 3 glgC Glucose-1-phosphate adenylyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q86HG0 1.51e-05 49 24 5 190 2 gmppA Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Dictyostelium discoideum
B9K6N9 1.62e-05 49 26 8 254 3 glgC Glucose-1-phosphate adenylyltransferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9WY82 1.85e-05 49 26 9 261 3 glgC Glucose-1-phosphate adenylyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B4RS18 1.86e-05 49 25 9 271 3 glgC Glucose-1-phosphate adenylyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1L9R3 1.87e-05 49 26 9 260 3 glgC Glucose-1-phosphate adenylyltransferase Thermotoga sp. (strain RQ2)
Q87QX6 1.9e-05 49 24 12 274 3 glgC1 Glucose-1-phosphate adenylyltransferase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1H1K1 2.02e-05 49 25 8 182 3 glgC Glucose-1-phosphate adenylyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1RLX5 2.15e-05 49 28 5 180 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella sp. (strain W3-18-1)
A4Y4U6 2.15e-05 49 28 5 180 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EGU3 2.53e-05 48 28 5 180 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7IFV2 3.16e-05 48 28 9 194 3 glgC Glucose-1-phosphate adenylyltransferase Thermosipho africanus (strain TCF52B)
Q3JCM9 5.8e-05 47 27 7 181 3 glgC Glucose-1-phosphate adenylyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q081Q7 7.37e-05 47 24 7 263 3 glgC Glucose-1-phosphate adenylyltransferase Shewanella frigidimarina (strain NCIMB 400)
A5IKI1 9.26e-05 47 25 9 260 3 glgC Glucose-1-phosphate adenylyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q15RP8 0.000116 47 26 5 179 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q82T88 0.000128 46 25 12 280 3 glgC Glucose-1-phosphate adenylyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9KDX4 0.000179 46 27 13 258 3 glgC Glucose-1-phosphate adenylyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8RF63 0.000184 46 25 7 194 3 glgC Glucose-1-phosphate adenylyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q4JUF1 0.000214 46 24 10 263 3 glgC Glucose-1-phosphate adenylyltransferase Corynebacterium jeikeium (strain K411)
Q8U1Z6 0.000274 45 21 10 238 1 PF1058 Bifunctional IPC transferase and DIPP synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P39122 0.000328 45 25 14 257 2 glgC Glucose-1-phosphate adenylyltransferase Bacillus subtilis (strain 168)
Q9KLP4 0.000351 45 22 9 267 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2RFM0 0.000496 44 35 3 81 3 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A7GUA0 0.000575 44 25 11 253 3 glgC Glucose-1-phosphate adenylyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5DZC0 0.000578 44 24 5 179 3 glgC Glucose-1-phosphate adenylyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5EUW3 0.000599 44 24 5 179 3 glgC Glucose-1-phosphate adenylyltransferase Aliivibrio fischeri (strain MJ11)
I3LUP1 0.000699 44 24 9 221 1 GMPPA Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Sus scrofa
Q5XIC1 0.000757 44 24 9 218 2 Gmppa Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Rattus norvegicus
Q1ISX7 0.000761 44 25 12 276 3 glgC Glucose-1-phosphate adenylyltransferase Koribacter versatilis (strain Ellin345)
P27897 0.000878 43 23 8 231 3 celA UTP--glucose-1-phosphate uridylyltransferase Komagataeibacter xylinus
Q7MJ49 0.001 43 24 5 179 3 glgC1 Glucose-1-phosphate adenylyltransferase 1 Vibrio vulnificus (strain YJ016)
B7GS87 0.001 43 26 8 199 3 glgC Glucose-1-phosphate adenylyltransferase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12935
Feature type CDS
Gene rfbA
Product glucose-1-phosphate thymidylyltransferase RfbA
Location 26195 - 27076 (strand: 1)
Length 882 (nucleotides) / 293 (amino acids)

Contig

Accession ZDB_370
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1333
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00483 Nucleotidyl transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1209 Cell wall/membrane/envelope biogenesis (M) M dTDP-glucose pyrophosphorylase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG048826 glucose-1-phosphate thymidylyltransferase VF0560 Immune modulation

Protein Sequence

MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREVLIISTPEDLPSFRRLLGNGDQFGISLSYAEQPSPDGLAQAFIIGEEFIGDDSCSLVLGDNIFFGHAFSPKLKSVAARTQGATVFGYQVMDPERFGVVEFDDEFRALSIEEKPVHPKSNWAVTGLYFYDNQVVDIAKQVKPSERGELEITSINQMYLERGELNVELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLNDEQVAESARQLAKTGYGQYLKNLLHVRPRQY

Flanking regions ( +/- flanking 50bp)

CGTATGCCGGACAGCGTCTGGGACTGGGTCAGGATAAGTAAGAGGCTGGTATGAAAGGAATTATTCTGGCGGGCGGCTCCGGAACCCGGTTGCACCCGATCACCCGCGGGGTGTCAAAACAGCTGCTGCCGATTTACGACAAGCCGATGATCTACTATCCGCTGTCCGTGCTGATGCTGGCCGGGATCCGCGAAGTCCTGATCATCTCAACACCGGAAGATCTGCCGTCATTCCGCCGTCTGCTGGGGAATGGTGATCAGTTCGGCATCTCTCTGAGCTATGCGGAACAGCCGTCGCCGGACGGCCTGGCACAGGCCTTTATTATCGGTGAGGAATTTATCGGTGATGACAGCTGCAGCCTGGTGCTGGGCGATAATATTTTCTTCGGCCATGCATTCAGCCCGAAACTGAAAAGTGTCGCAGCCCGGACGCAGGGCGCGACTGTTTTCGGCTACCAGGTGATGGACCCGGAACGTTTCGGGGTGGTGGAATTTGATGATGAATTCCGCGCGCTGTCGATTGAGGAAAAACCGGTTCATCCGAAATCCAACTGGGCGGTTACCGGATTGTATTTCTATGATAATCAGGTGGTTGATATCGCGAAGCAGGTGAAACCGTCTGAGCGCGGCGAACTGGAAATCACCAGTATCAACCAGATGTATCTGGAGCGCGGCGAACTGAATGTTGAGCTGCTCGGCCGTGGTTTTGCCTGGCTGGACACCGGTACTCACGACAGTCTGATTGAAGCCAGCACCTTTGTACAGACGGTTGAAAAACGTCAGGGCTTTAAAATTGCCTGTCTGGAAGAGATTGCCTGGCGCAACGGCTGGCTGAATGACGAACAGGTGGCAGAATCCGCCCGTCAGCTGGCGAAGACCGGTTATGGTCAGTATCTGAAGAATTTACTCCATGTCCGTCCGCGCCAGTATTGAGCATCTCGCCTGGGAAAGTGACTTTTTTGCCCTGAAAACGGCAAAACTGG