Homologs in group_1385

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08220 FBDBKF_08220 100.0 Morganella morganii S1 wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
EHELCC_13305 EHELCC_13305 100.0 Morganella morganii S2 wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
NLDBIP_13645 NLDBIP_13645 100.0 Morganella morganii S4 wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
HKOGLL_12120 HKOGLL_12120 100.0 Morganella morganii S5 wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
F4V73_RS18770 F4V73_RS18770 95.0 Morganella psychrotolerans wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
PMI_RS16480 PMI_RS16480 74.2 Proteus mirabilis HI4320 wecA UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase

Distribution of the homologs in the orthogroup group_1385

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1385

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZAE1 2.16e-175 494 73 1 355 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Yersinia pestis
Q9L6R7 2.33e-169 479 70 1 344 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z386 1.86e-168 477 69 1 343 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Salmonella typhi
Q8XAS7 2.57e-165 469 70 1 343 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Escherichia coli O157:H7
P0AC80 1.92e-164 466 69 1 343 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Shigella flexneri
P0AC78 1.92e-164 466 69 1 343 1 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Escherichia coli (strain K12)
P0AC79 1.92e-164 466 69 1 343 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45341 2.27e-127 372 52 3 353 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CNG8 1.42e-125 367 54 5 340 3 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Pasteurella multocida (strain Pm70)
O34753 4.47e-35 134 30 7 301 1 tagO Probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase Bacillus subtilis (strain 168)
A0R211 4.55e-21 96 28 13 335 1 wecA Decaprenyl-phosphate N-acetylglucosaminephosphotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WMW5 1.73e-20 95 28 13 329 1 wecA Decaprenyl-phosphate N-acetylglucosaminephosphotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMW4 1.73e-20 95 28 13 329 3 wecA Decaprenyl-phosphate N-acetylglucosaminephosphotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P45830 1.66e-19 92 28 13 335 3 wecA Decaprenyl-phosphate N-acetylglucosaminephosphotransferase Mycobacterium leprae (strain TN)
Q819Q1 2.41e-17 85 32 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6P9 2.41e-17 85 32 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain B4264)
Q6HEQ1 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636B3 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ZK / E33L)
B9IVZ0 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain Q1)
B7HM34 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH187)
C1EPS7 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain 03BB102)
B7IUS3 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain G9842)
Q732F5 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JK01 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH820)
A0RHT4 1.17e-16 83 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis (strain Al Hakam)
Q9X1N5 1.59e-16 82 27 15 340 1 wecA Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A9VU75 5.36e-16 81 32 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus mycoides (strain KBAB4)
Q81WC8 5.73e-16 81 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis
C3L712 5.73e-16 81 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P683 5.73e-16 81 31 7 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain A0248)
A4IM06 2.25e-14 76 30 7 208 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus thermodenitrificans (strain NG80-2)
Q5L0X8 5.83e-14 75 29 5 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus kaustophilus (strain HTA426)
C5D8M1 1.15e-13 74 31 9 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus sp. (strain WCH70)
Q8Y5M0 2.28e-13 73 30 7 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XX6 2.7e-13 73 30 7 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWZ0 2.7e-13 73 30 7 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A7GRN9 4e-13 72 28 6 208 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7GGI5 5.4e-13 72 29 7 208 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q929Y0 1.07e-12 71 30 7 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AKD7 1.69e-12 70 29 7 211 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A8GVM4 2.46e-12 70 26 13 307 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain OSU 85-389)
Q1RI79 4.57e-12 70 26 13 307 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain RML369-C)
Q1WT98 4.21e-11 66 31 11 235 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ligilactobacillus salivarius (strain UCC118)
Q03QH3 6.31e-11 66 28 10 228 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1MXV8 1.69e-10 65 26 5 239 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leuconostoc citreum (strain KM20)
Q03EY0 2.03e-10 64 28 7 205 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q5GRZ3 2.31e-10 64 26 11 301 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
B0JFF7 2.53e-10 64 30 8 207 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q7V9F5 2.55e-10 64 30 10 225 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B2GB76 3.64e-10 63 27 8 236 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C1CW54 3.84e-10 63 29 10 224 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q2YXE0 8.2e-10 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0C1R8 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus
A8Z3M3 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GHQ3 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MRSA252)
P68783 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain N315)
P68782 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG82 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Newman)
Q5HGP9 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain COL)
A5IS68 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain JH9)
Q2FZ93 1.63e-09 62 26 8 212 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHQ5 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300)
A6U102 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain JH1)
A7X1C2 1.63e-09 62 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q3AVL6 3.52e-09 61 27 9 243 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Synechococcus sp. (strain CC9902)
Q8NX36 4.07e-09 60 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MW2)
Q6GA30 4.07e-09 60 26 8 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MSSA476)
Q5WFG7 6.93e-09 60 29 8 207 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shouchella clausii (strain KSM-K16)
Q0I604 8.22e-09 60 29 7 185 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Synechococcus sp. (strain CC9311)
A4XI01 1.3e-08 59 24 9 268 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q6AJ51 1.41e-08 59 27 11 313 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C0R4W3 1.51e-08 58 28 8 215 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B1XNS2 1.91e-08 58 31 8 201 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q03521 2.08e-08 58 27 5 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus subtilis (strain 168)
Q2G998 2.45e-08 58 27 15 311 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B9DPR2 4.6e-08 57 29 5 154 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus carnosus (strain TM300)
Q88V79 5.22e-08 57 24 10 243 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q7UZF8 5.82e-08 57 25 8 230 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2RD43 6.75e-08 57 31 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5G1 7e-08 57 31 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q03J12 9.59e-08 56 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LY94 9.59e-08 56 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus thermophilus (strain CNRZ 1066)
Q7NEY9 9.87e-08 56 31 9 200 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
C1CPL3 1.3e-07 56 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain Taiwan19F-14)
Q8CPK7 1.37e-07 56 26 8 213 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ10 1.37e-07 56 26 8 213 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49WW4 1.47e-07 56 29 8 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7V3S7 1.52e-07 56 28 10 213 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain MIT 9313)
Q9RTD0 1.78e-07 55 25 8 228 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9K9S6 1.84e-07 55 26 7 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7Z4E2 2.1e-07 55 26 7 295 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O07668 2.17e-07 55 26 7 217 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Enterococcus hirae
Q5M2U9 2.22e-07 55 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
O07107 2.4e-07 55 30 3 145 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q9AKD8 2.43e-07 55 24 8 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q7U3B6 3.22e-07 55 26 9 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Parasynechococcus marenigrum (strain WH8102)
Q039R9 3.48e-07 55 27 9 207 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q661W1 3.79e-07 55 25 10 281 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A8G7L4 4.77e-07 54 29 5 165 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain MIT 9215)
Q182Y8 4.92e-07 54 25 5 203 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridioides difficile (strain 630)
B2G6K3 5.41e-07 54 25 8 237 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ31 5.41e-07 54 25 8 237 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Limosilactobacillus reuteri (strain DSM 20016)
Q73G61 5.58e-07 54 30 6 153 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wolbachia pipientis wMel
Q31I62 6.02e-07 54 27 10 250 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0Q060 6.54e-07 53 25 7 205 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium novyi (strain NT)
B1I956 6.99e-07 53 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain Hungary19A-6)
A9BGS8 7.82e-07 53 26 8 203 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q8NZY2 8.02e-07 53 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
B2TS25 9.18e-07 53 26 5 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Eklund 17B / Type B)
Q8ER51 9.59e-07 53 29 9 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A3PFJ8 9.78e-07 53 28 4 153 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain MIT 9301)
B7J1N1 1.24e-06 53 25 9 280 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ZS7)
Q44776 1.24e-06 53 25 9 280 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q5XAL6 1.47e-06 53 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A5GPT3 1.48e-06 53 27 9 221 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Synechococcus sp. (strain WH7803)
Q55986 1.53e-06 53 24 10 303 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B2V4V5 1.55e-06 52 25 6 206 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Alaska E43 / Type E3)
P0DB43 1.97e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB42 1.97e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B2ISQ5 2.01e-06 52 28 6 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain CGSP14)
B8ZL54 2.01e-06 52 28 6 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q04ES8 2.21e-06 52 26 10 273 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
C1CIK1 2.22e-06 52 31 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain P1031)
Q3AG75 2.24e-06 52 29 4 157 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Synechococcus sp. (strain CC9605)
B5YFT8 2.4e-06 52 25 8 251 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A2BZ97 2.54e-06 52 28 5 163 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain MIT 9515)
A6LTS6 3.07e-06 52 27 7 203 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q48RZ3 3.09e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JFL1 3.09e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JKM0 3.09e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAG8 3.09e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q99YK2 3.09e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M1
P0CB59 3.18e-06 52 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CBB5 3.18e-06 52 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain 70585)
Q04B74 3.18e-06 52 29 9 205 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAT7 3.18e-06 52 29 9 205 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q1IKG7 3.22e-06 52 22 8 238 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Koribacter versatilis (strain Ellin345)
B5XML0 3.39e-06 52 30 4 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pyogenes serotype M49 (strain NZ131)
Q65JY3 3.49e-06 52 27 6 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1GRX6 3.5e-06 52 23 8 305 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0BZI7 3.55e-06 52 29 9 208 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acaryochloris marina (strain MBIC 11017)
Q2NCZ3 4.15e-06 51 26 8 218 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Erythrobacter litoralis (strain HTCC2594)
Q0SNK7 4.44e-06 51 24 9 279 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella afzelii (strain PKo)
Q46I69 4.77e-06 51 29 5 149 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain NATL2A)
Q4L5N3 4.85e-06 51 35 2 93 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus haemolyticus (strain JCSC1435)
B4S6R2 6.77e-06 51 26 5 195 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A8MH33 6.92e-06 50 25 6 212 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alkaliphilus oremlandii (strain OhILAs)
Q3A2G3 7.34e-06 50 24 5 218 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A8ZXW6 7.63e-06 50 26 8 248 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8DR69 8.33e-06 50 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MC4 8.33e-06 50 30 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B7JVF4 9.66e-06 50 37 2 94 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q5P9K3 1.19e-05 50 25 11 279 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaplasma marginale (strain St. Maries)
B9KH29 1.19e-05 50 25 11 279 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaplasma marginale (strain Florida)
A4SH05 1.42e-05 50 26 6 222 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A0RQL9 1.46e-05 50 26 11 235 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter fetus subsp. fetus (strain 82-40)
Q7VGZ9 1.51e-05 50 26 10 237 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B5E6Z5 1.59e-05 49 29 7 198 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus pneumoniae serotype 19F (strain G54)
A8YUN7 1.61e-05 49 26 2 146 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lactobacillus helveticus (strain DPC 4571)
Q8KGD1 1.71e-05 50 25 6 222 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q255W8 1.96e-05 49 35 2 93 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlamydia felis (strain Fe/C-56)
B9K6P4 2.03e-05 49 26 7 199 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B3CVD3 2.57e-05 49 28 6 175 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Orientia tsutsugamushi (strain Ikeda)
C3MEN2 2.71e-05 49 24 12 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A5N7E7 2.84e-05 48 25 9 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E0W0 2.84e-05 48 25 9 209 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain NBRC 12016)
Q5FKV4 3.02e-05 48 33 1 86 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q821S0 3.13e-05 48 39 5 107 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9AKP2 3.17e-05 48 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia montanensis
Q38XN0 3.53e-05 48 36 3 91 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Latilactobacillus sakei subsp. sakei (strain 23K)
B9L7V6 3.57e-05 48 24 7 246 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q8DVM4 3.65e-05 48 25 7 227 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A0LTM0 3.73e-05 48 31 8 176 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B8GMM6 3.75e-05 48 27 9 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q9ZCW0 3.86e-05 48 25 8 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia prowazekii (strain Madrid E)
C5CDR2 3.95e-05 48 26 6 200 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q3B126 4.1e-05 48 25 8 224 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q8R9G3 4.24e-05 48 26 5 199 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A8EY83 4.45e-05 48 22 12 318 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia canadensis (strain McKiel)
A1BJY1 4.53e-05 48 23 6 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
O66465 5.44e-05 48 25 8 268 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aquifex aeolicus (strain VF5)
Q2RVU1 5.5e-05 48 26 9 251 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B1L9R8 6.15e-05 47 27 11 201 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermotoga sp. (strain RQ2)
A5IKI6 6.15e-05 47 27 11 201 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q03W33 6.62e-05 47 26 5 185 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B7KDB2 6.71e-05 48 25 13 299 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gloeothece citriformis (strain PCC 7424)
B3QWT4 6.94e-05 48 24 8 250 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B5RRC2 7.76e-05 47 23 8 279 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia recurrentis (strain A1)
Q82AD9 7.81e-05 47 28 6 160 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9WY77 8.43e-05 47 27 10 199 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8FCX8 9.34e-05 47 31 6 179 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus pumilus (strain SAFR-032)
B4SHE7 9.82e-05 47 23 5 222 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A8GP69 0.000106 47 24 7 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia akari (strain Hartford)
C1A8A7 0.000106 47 24 10 265 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q8D2Z3 0.000108 47 27 7 210 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wigglesworthia glossinidia brevipalpis
Q9HVZ8 0.000116 47 35 2 103 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H25 0.000116 47 35 2 103 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZJ3 0.000116 47 35 2 103 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain LESB58)
A6VB88 0.000116 47 35 2 103 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain PA7)
Q0SRW4 0.000117 47 28 8 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium perfringens (strain SM101 / Type A)
Q5WTI4 0.000121 47 27 7 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Lens)
A8F278 0.000148 47 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia massiliae (strain Mtu5)
A1QZ99 0.000167 46 27 5 215 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia turicatae (strain 91E135)
Q0TP97 0.00017 46 28 8 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XJA1 0.000179 46 28 8 204 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium perfringens (strain 13 / Type A)
Q317T2 0.000187 46 28 2 99 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prochlorococcus marinus (strain MIT 9312)
A8GSX5 0.000192 46 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Sheila Smith)
B0BYF0 0.000192 46 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Iowa)
Q9AKI9 0.000192 46 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii
Q01Q45 0.000197 46 24 9 238 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Solibacter usitatus (strain Ellin6076)
A4J2A8 0.000202 46 27 5 190 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B5RLC9 0.000216 46 23 8 279 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia duttonii (strain Ly)
A5FUK7 0.000242 46 24 7 238 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidiphilium cryptum (strain JF-5)
A5IAV9 0.000262 46 26 6 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Corby)
Q5X1S3 0.000262 46 26 6 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Paris)
Q3MDP5 0.000265 46 25 11 308 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5ZSA2 0.000276 46 26 6 220 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q1QVG4 0.000278 46 26 8 227 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
O26830 0.000298 45 25 6 168 3 MTH_735 Putative phospho-N-acetylmuramoyl-pentapeptide-transferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
B0TQN4 0.000312 45 25 7 235 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella halifaxensis (strain HAW-EB4)
B9MQ98 0.000338 45 27 5 147 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8YP83 0.000394 45 27 7 203 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A8FQ97 0.000423 45 26 8 221 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sediminis (strain HAW-EB3)
A8EW04 0.000493 45 25 9 231 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliarcobacter butzleri (strain RM4018)
Q6LMF3 0.000523 45 26 9 236 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Photobacterium profundum (strain SS9)
B4RWY2 0.000528 45 31 2 110 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q92H61 0.000534 45 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q82VS6 0.000594 45 26 11 245 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C3PP35 0.000605 45 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia africae (strain ESF-5)
C4K1S5 0.000626 45 23 11 310 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia peacockii (strain Rustic)
B6IRG5 0.000716 44 23 10 318 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum centenum (strain ATCC 51521 / SW)
A7HK75 0.000724 44 36 3 88 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B3EIL1 0.000814 44 25 7 223 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
C1DQ96 0.000868 44 35 2 103 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8G5X7 0.001 44 35 2 80 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chloroflexus aggregans (strain MD-66 / DSM 9485)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12910
Feature type CDS
Gene wecA
Product UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
Location 20457 - 21533 (strand: 1)
Length 1077 (nucleotides) / 358 (amino acids)
In genomic island -

Contig

Accession ZDB_370
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1385
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00953 Glycosyl transferase family 4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0472 Cell wall/membrane/envelope biogenesis (M) M UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

Kegg Ortholog Annotation(s)

Protein Sequence

MLTEILIIFVFATATVFVARKAGVAVGLVDKPNYRKKHQGLVPLVGGISIFISVCFAFLISDEFIAHKFIYLGCAGALVLVGALDDRFDLSVKLRAGVQAVVAIIMMVFANLKIDSLGHAFGPWELTLGPFSYVLTLFAVWGAVNAFNMVDGIDGLLGGLSCVSFGALGILFALSGNSGLAFWCFTFIAAILPYICFNLGLFGRRFKVFMGDAGSTLIGFTIIWLLTSASQGGEPHAINAVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLIMRSGFTSRESFVVITLAAAVLAAIGIAGQVLSFVPEWVMLALFLLAFIMYGYCIKRAWKVARFIKRHRRRVRRKSVTH

Flanking regions ( +/- flanking 50bp)

GGCCGGCAGGGATAATAAAAATATCAGAAAGGGTTGTTGTGAATCTCACTATGTTAACTGAAATCCTAATCATATTTGTGTTCGCCACAGCGACGGTCTTTGTTGCCCGTAAGGCTGGCGTCGCTGTCGGTTTGGTGGATAAACCCAATTACCGCAAAAAGCATCAGGGACTGGTCCCGCTGGTCGGCGGAATATCTATTTTTATCAGTGTCTGCTTTGCTTTCCTCATCAGTGATGAGTTTATTGCGCATAAATTTATTTATCTCGGGTGCGCCGGTGCACTGGTGCTGGTCGGGGCGCTCGATGACCGGTTTGACCTCAGTGTGAAACTGCGGGCCGGTGTTCAGGCAGTGGTTGCTATCATTATGATGGTGTTTGCCAACCTGAAAATCGACAGCCTGGGGCATGCATTCGGGCCGTGGGAACTGACACTCGGGCCGTTCAGCTATGTGCTGACACTGTTTGCGGTATGGGGCGCGGTGAATGCGTTCAATATGGTGGATGGTATCGACGGGCTGCTCGGCGGGCTTTCCTGTGTCTCTTTCGGCGCATTGGGGATCCTGTTTGCCCTGAGCGGTAACAGTGGCCTGGCATTCTGGTGCTTTACCTTTATCGCTGCCATTCTGCCGTATATCTGCTTTAACCTCGGACTGTTCGGCCGCCGCTTTAAAGTGTTTATGGGGGATGCGGGCAGTACGCTGATCGGGTTCACCATTATCTGGCTGCTGACATCGGCCTCACAGGGCGGGGAGCCGCATGCAATTAATGCAGTGACCGCACTGTGGATTATCGCCATTCCGCTGATGGATATGGTGGCGATTATGTACCGCCGTCTGCGCAAAGGGATGAGCCCGTTTTCACCGGATCGCCAGCATATTCATCATCTGATTATGCGTTCCGGGTTTACGTCCCGTGAATCCTTTGTGGTGATAACCCTTGCTGCGGCAGTATTAGCGGCCATTGGTATTGCCGGACAGGTCCTCAGCTTTGTCCCTGAGTGGGTGATGCTGGCACTGTTCTTGCTTGCTTTCATTATGTACGGCTACTGCATAAAACGCGCCTGGAAAGTTGCCCGTTTTATCAAACGCCACAGACGCCGCGTGCGTCGCAAATCGGTCACACACTAAATTTTTAACCACAGAGGCACATGTTGATATGCGTTCAGAAAATACTCCGG