Homologs in group_1050

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05430 FBDBKF_05430 100.0 Morganella morganii S1 msrB Peptide methionine sulfoxide reductase MsrB
EHELCC_12160 EHELCC_12160 100.0 Morganella morganii S2 msrB Peptide methionine sulfoxide reductase MsrB
NLDBIP_12500 NLDBIP_12500 100.0 Morganella morganii S4 msrB Peptide methionine sulfoxide reductase MsrB
HKOGLL_10975 HKOGLL_10975 100.0 Morganella morganii S5 msrB Peptide methionine sulfoxide reductase MsrB
F4V73_RS03865 F4V73_RS03865 92.5 Morganella psychrotolerans msrB peptide-methionine (R)-S-oxide reductase MsrB
PMI_RS07285 PMI_RS07285 61.3 Proteus mirabilis HI4320 msrB peptide-methionine (R)-S-oxide reductase MsrB

Distribution of the homologs in the orthogroup group_1050

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1050

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GFD8 9.73e-68 204 68 1 130 3 msrB Peptide methionine sulfoxide reductase MsrB Serratia proteamaculans (strain 568)
Q7N400 9.62e-66 198 70 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JLG2 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66AP6 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TJB4 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis (strain Pestoides F)
Q1CJ76 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R9C4 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEK7 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis
B2K3R4 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C7U0 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FI81 2.64e-65 197 68 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9MFH4 5.87e-65 196 65 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P65449 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65450 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella typhi
B4TUA8 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella schwarzengrund (strain CVM19633)
A9N292 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3Y1 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella newport (strain SL254)
B4TGC8 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella heidelberg (strain SL476)
B5FJF9 1.26e-64 196 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella dublin (strain CT_02021853)
B5F860 2.26e-64 195 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella agona (strain SL483)
B7LQ21 2.97e-64 195 64 0 131 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6T7R0 1.68e-63 193 65 1 135 3 msrB Peptide methionine sulfoxide reductase MsrB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XS71 3.31e-63 192 69 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Klebsiella pneumoniae (strain 342)
Q83L66 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella flexneri
Q0T4Y5 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella flexneri serotype 5b (strain 8401)
Q321R4 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella boydii serotype 4 (strain Sb227)
B1IPF3 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0X0 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O9:H4 (strain HS)
B7M1J2 6.25e-63 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O8 (strain IAI1)
Q3Z2B6 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella sonnei (strain Ss046)
B1LDV3 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain SMS-3-5 / SECEC)
B6IBJ9 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain SE11)
B7N5B4 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A746 1.14e-62 191 62 0 137 1 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12)
P0A747 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH50 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XGN8 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12 / DH10B)
C4ZZD4 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12 / MC4100 / BW2952)
B7NSZ8 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ71 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A748 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O157:H7
B7L6Q3 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain 55989 / EAEC)
B7USF8 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMP8 1.14e-62 191 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O139:H28 (strain E24377A / ETEC)
B7MVQ9 2.06e-62 190 62 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O81 (strain ED1a)
A1JQG8 2.57e-62 190 66 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7MAY9 2.81e-62 190 61 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O45:K1 (strain S88 / ExPEC)
C6DGV8 8.95e-62 189 65 1 129 3 msrB Peptide methionine sulfoxide reductase MsrB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VJ36 1.53e-61 188 61 0 130 3 msrB Peptide methionine sulfoxide reductase MsrB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q32GC7 2.33e-61 187 60 0 137 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella dysenteriae serotype 1 (strain Sd197)
Q6D4P7 7.42e-61 186 64 1 129 3 msrB Peptide methionine sulfoxide reductase MsrB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9CMB1 6.27e-55 171 58 1 132 3 msrB Peptide methionine sulfoxide reductase MsrB Pasteurella multocida (strain Pm70)
B4RUW0 3.42e-52 164 56 1 138 3 msrB Peptide methionine sulfoxide reductase MsrB Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q9I016 3.78e-49 156 59 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NZ0 3.78e-49 156 59 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UUZ9 3.78e-49 156 59 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain LESB58)
A6V3R3 4.18e-49 156 59 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain PA7)
Q8D849 9.24e-49 156 56 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio vulnificus (strain CMCP6)
Q87MS5 1.07e-48 155 57 0 114 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MMC4 1.3e-48 156 56 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio vulnificus (strain YJ016)
Q8XYL1 4.77e-48 153 59 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5R930 1.3e-47 154 54 0 124 2 MSRB3 Methionine-R-sulfoxide reductase B3 Pongo abelii
Q92RA4 1.44e-47 152 58 0 118 3 msrB1 Peptide methionine sulfoxide reductase MsrB 1 Rhizobium meliloti (strain 1021)
A5GQT3 2.68e-47 152 56 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Synechococcus sp. (strain RCC307)
Q8IXL7 5.41e-47 153 53 0 124 1 MSRB3 Methionine-R-sulfoxide reductase B3 Homo sapiens
Q8DJK9 6.37e-47 151 58 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q46EH1 8.64e-47 150 58 0 117 3 msrB Peptide methionine sulfoxide reductase MsrB Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8BU85 1.84e-46 154 58 0 113 1 Msrb3 Methionine-R-sulfoxide reductase B3, mitochondrial Mus musculus
A4XVB1 2.21e-46 149 55 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas mendocina (strain ymp)
C1DRM1 2.65e-46 149 55 1 128 3 msrB Peptide methionine sulfoxide reductase MsrB Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8GMG5 9.36e-46 148 62 0 107 3 msrB Peptide methionine sulfoxide reductase MsrB Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C3LNU9 1.55e-45 148 55 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain M66-2)
Q9KQK0 1.55e-45 148 55 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6R2 1.55e-45 148 55 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q88LQ6 2.74e-45 147 54 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3PK10 3.73e-45 147 55 1 133 3 msrB Peptide methionine sulfoxide reductase MsrB Cellvibrio japonicus (strain Ueda107)
Q1ID16 3.8e-45 146 58 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas entomophila (strain L48)
Q8PWF5 4.03e-45 146 54 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8UGX7 5.29e-45 146 57 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Agrobacterium fabrum (strain C58 / ATCC 33970)
B1J4W5 5.31e-45 146 54 1 128 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain W619)
A2SGN7 5.61e-45 146 56 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0KUQ0 6.28e-45 145 53 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain GB-1)
C3K735 1.25e-44 145 59 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain SBW25)
Q1QXV3 1.29e-44 145 59 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q48FR2 1.31e-44 145 56 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2SJP9 1.43e-44 145 57 0 114 3 msrB Peptide methionine sulfoxide reductase MsrB Hahella chejuensis (strain KCTC 2396)
Q3K935 2.66e-44 144 58 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain Pf0-1)
Q3SJU1 2.87e-44 144 56 1 128 3 msrB Peptide methionine sulfoxide reductase MsrB Thiobacillus denitrificans (strain ATCC 25259)
A5W756 3.86e-44 144 53 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q12AE4 7.2e-44 143 61 0 107 3 msrB Peptide methionine sulfoxide reductase MsrB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q4K8U5 8.59e-44 143 60 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1VNB7 8.86e-44 143 55 2 134 3 msrB Peptide methionine sulfoxide reductase MsrB Polaromonas naphthalenivorans (strain CJ2)
Q6FAL8 2.28e-43 142 52 1 130 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4ZQC6 3.44e-43 141 54 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas syringae pv. syringae (strain B728a)
Q885Q1 5.87e-43 140 55 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8F7W8 6.7e-43 140 54 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NN2 6.7e-43 140 54 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C5BR54 1.26e-42 140 52 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q6ADJ8 1.51e-42 140 57 1 118 3 msrB Peptide methionine sulfoxide reductase MsrB Leifsonia xyli subsp. xyli (strain CTCB07)
Q47EU6 1.87e-42 139 56 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Dechloromonas aromatica (strain RCB)
Q0A706 3.53e-42 139 53 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5CNS9 3.76e-42 139 59 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Variovorax paradoxus (strain S110)
Q21LK2 6.53e-42 138 52 1 131 3 msrB Peptide methionine sulfoxide reductase MsrB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
O26807 2.15e-41 137 59 0 106 1 msrB Peptide methionine sulfoxide reductase MsrB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q89EM9 2.73e-41 137 55 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5WH73 4.4e-41 136 51 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Shouchella clausii (strain KSM-K16)
Q87AJ9 6.4e-41 136 53 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8Y4 6.4e-41 136 53 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain M23)
A4G5V5 9.43e-41 135 53 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Herminiimonas arsenicoxydans
B8GY23 1.03e-40 136 58 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A6B1 1.03e-40 136 58 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q39FG2 2.1e-40 134 54 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9KCX2 2.15e-40 134 51 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4JEZ1 2.56e-40 134 54 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AJS6 3.08e-40 134 54 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia multivorans (strain ATCC 17616 / 249)
B1JTT6 3.29e-40 134 54 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia orbicola (strain MC0-3)
B4EBK9 3.4e-40 134 54 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0BEH0 5.69e-40 134 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B0VC45 8.15e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AYE)
A3M4Q3 8.15e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HYT2 8.15e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain ACICU)
B7I415 8.15e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AB0057)
B7H3X2 8.15e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AB307-0294)
B0VR86 8.33e-40 133 48 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain SDF)
Q9PF29 1.14e-39 133 52 0 115 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain 9a5c)
B1YRN6 1.17e-39 133 52 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia ambifaria (strain MC40-6)
Q71YF7 1.4e-39 132 51 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4b (strain F2365)
C1KWF8 1.4e-39 132 51 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4b (strain CLIP80459)
P65448 1.66e-39 132 53 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Brucella suis biovar 1 (strain 1330)
P65447 1.66e-39 132 53 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8Y641 1.98e-39 132 51 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1BH71 2.46e-39 132 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia orbicola (strain AU 1054)
A0K833 2.46e-39 132 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia cenocepacia (strain HI2424)
Q78J03 3.53e-39 132 51 1 129 1 Msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Mus musculus
Q4FZX5 3.95e-39 132 51 1 131 2 Msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Rattus norvegicus
Q92Y46 4.14e-39 131 55 1 116 3 msrB2 Peptide methionine sulfoxide reductase MsrB 2 Rhizobium meliloti (strain 1021)
B0BYW4 4.43e-39 131 53 0 120 3 msrB Peptide methionine sulfoxide reductase MsrB Acaryochloris marina (strain MBIC 11017)
B1HZH4 5.77e-39 131 52 1 121 3 msrB Peptide methionine sulfoxide reductase MsrB Lysinibacillus sphaericus (strain C3-41)
Q2SWN9 5.94e-39 131 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0DC89 8.78e-39 133 52 0 115 1 MSRB1 Peptide methionine sulfoxide reductase B1, chloroplastic Oryza sativa subsp. japonica
Q63V23 9.93e-39 130 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia pseudomallei (strain K96243)
A1V4U8 9.93e-39 130 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain SAVP1)
Q62JM6 9.93e-39 130 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain ATCC 23344)
A2SBI6 9.93e-39 130 53 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain NCTC 10229)
A0AJW4 1.3e-38 130 50 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9C8M2 1.68e-38 132 50 2 128 1 MSRB1 Peptide methionine sulfoxide reductase B1, chloroplastic Arabidopsis thaliana
B8DDP3 1.78e-38 130 50 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4a (strain HCC23)
Q65ID2 1.91e-38 130 52 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8FEA3 2.59e-38 129 51 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus pumilus (strain SAFR-032)
Q3JRF0 2.96e-38 129 53 1 115 1 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia pseudomallei (strain 1710b)
P34436 5.35e-38 129 53 3 126 3 F44E2.6 Probable methionine-R-sulfoxide reductase B Caenorhabditis elegans
Q92AE9 1.25e-37 127 50 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9Y3D2 1.6e-37 129 49 1 131 1 MSRB2 Methionine-R-sulfoxide reductase B2, mitochondrial Homo sapiens
E6ESW1 7.42e-37 125 53 1 114 1 msrB Peptide methionine sulfoxide reductase MsrB Enterococcus faecalis (strain TX4000 / JH2-2)
P0DM32 7.42e-37 125 53 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Enterococcus faecalis (strain ATCC 700802 / V583)
Q9ZNJ9 9.28e-37 126 50 2 125 3 msrB Peptide methionine sulfoxide reductase MsrB Hathewaya histolytica
Q97IU0 1.04e-36 125 50 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6NW52 3.04e-36 125 49 1 130 2 msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Danio rerio
A7Z5S1 3.78e-36 124 50 0 120 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P0A3R0 1.54e-35 127 53 2 125 1 msrAB1 Peptide methionine sulfoxide reductase MsrA/MsrB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Q9 1.54e-35 127 53 2 125 1 msrAB1 Peptide methionine sulfoxide reductase MsrA/MsrB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P54155 4.76e-35 121 49 1 120 1 msrB Peptide methionine sulfoxide reductase MsrB Bacillus subtilis (strain 168)
Q8INK9 6.66e-35 122 48 2 135 1 SelR Methionine-R-sulfoxide reductase B1 Drosophila melanogaster
P47686 5.75e-34 119 47 2 129 3 msrB Peptide methionine sulfoxide reductase MsrB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q93KF3 7.63e-34 123 48 1 121 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Campylobacter fetus
Q8XJZ6 1.02e-33 118 52 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain 13 / Type A)
Q0TPZ6 1.02e-33 118 52 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SSL4 1.07e-33 118 52 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain SM101 / Type A)
Q9LAM9 1.21e-33 122 49 1 115 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P75129 1.06e-32 115 47 2 129 3 msrB Peptide methionine sulfoxide reductase MsrB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q72EK2 1.22e-32 115 50 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9KLX6 1.54e-32 120 49 0 115 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88W33 1.98e-32 114 50 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8E026 3.13e-32 114 52 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5Q9 3.13e-32 114 52 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype III (strain NEM316)
Q3K1F5 3.13e-32 114 52 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9RUK6 3.84e-32 114 49 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1WVT3 3.67e-31 111 48 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Ligilactobacillus salivarius (strain UCC118)
Q9AL99 5.29e-31 116 50 1 116 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Aggregatibacter actinomycetemcomitans
B9DNY9 7.29e-31 110 47 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus carnosus (strain TM300)
P86890 1.67e-30 114 51 1 115 1 msrAB Peptide methionine sulfoxide reductase msrA/msrB Enterococcus faecalis
P0DC43 2.15e-30 109 47 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC42 2.15e-30 109 47 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99ZV6 3.59e-30 108 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M1
Q8P172 7.04e-30 108 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q032Q9 7.78e-30 108 50 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. cremoris (strain SK11)
Q5XCD0 8.19e-30 108 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9ZMK8 9.82e-30 113 50 1 115 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Helicobacter pylori (strain J99 / ATCC 700824)
O25011 1.07e-29 113 50 1 115 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Helicobacter pylori (strain ATCC 700392 / 26695)
Q2YY44 1.15e-29 107 46 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9Y7K1 1.77e-29 107 43 3 122 3 SPBC216.04c Uncharacterized protein C216.04c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0A087 1.82e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MW2)
A8Z402 1.82e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9D8 1.82e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MSSA476)
A6QGX4 1.82e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Newman)
P0A088 1.82e-29 107 45 2 121 1 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH15 1.82e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain USA300)
Q8CSK6 1.9e-29 107 42 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB4 1.9e-29 107 42 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GGY4 2.21e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MRSA252)
P99065 2.21e-29 107 45 2 121 1 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain N315)
P65451 2.21e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISV4 2.21e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain JH9)
A6U1P3 2.21e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain JH1)
A7X2A9 2.21e-29 107 45 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4L6D3 2.87e-29 106 44 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus haemolyticus (strain JCSC1435)
P65444 4.92e-29 110 50 1 107 3 msrAB2 Peptide methionine sulfoxide reductase MsrA/MsrB 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65443 4.92e-29 110 50 1 107 3 msrAB2 Peptide methionine sulfoxide reductase MsrA/MsrB 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P45213 6.28e-29 110 48 1 116 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9K1N8 8.6e-29 112 50 1 114 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JWM8 8.6e-29 112 50 1 114 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9CJ17 1.15e-28 105 48 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. lactis (strain IL1403)
Q49XN4 1.18e-28 105 41 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A2RHS0 1.34e-28 104 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. cremoris (strain MG1363)
C0M8H8 1.54e-28 104 41 1 124 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus equi subsp. equi (strain 4047)
P14930 1.79e-28 111 50 1 114 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria gonorrhoeae
O83641 2.24e-28 108 47 1 114 3 msrAB Peptide methionine sulfoxide reductase MsrB/MsrA Treponema pallidum (strain Nichols)
P0DC41 3.05e-28 108 45 1 119 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC40 3.05e-28 108 45 1 119 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
C0MDV8 5.04e-28 103 41 1 124 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus equi subsp. zooepidemicus (strain H70)
P25566 1.3e-27 103 43 2 123 1 MXR2 Peptide methionine sulfoxide reductase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8P046 1.67e-27 106 48 1 107 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XAX5 1.72e-27 106 48 1 107 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99YT1 1.72e-27 106 48 1 107 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M1
Q9M0Z6 3.09e-27 102 45 3 117 2 MSRB3 Peptide methionine sulfoxide reductase B3 Arabidopsis thaliana
Q9ZS91 1.02e-24 95 40 2 125 1 MSRB5 Peptide methionine sulfoxide reductase B5 Arabidopsis thaliana
Q9C5C8 3.05e-24 95 42 2 121 1 MSRB2 Peptide methionine sulfoxide reductase B2, chloroplastic Arabidopsis thaliana
Q84JT6 3.7e-23 90 40 3 125 2 MSRB9 Peptide methionine sulfoxide reductase B9 Arabidopsis thaliana
Q10L32 9.59e-23 89 41 2 117 2 MSRB5 Peptide methionine sulfoxide reductase B5 Oryza sativa subsp. japonica
Q9M0Z5 1.02e-22 89 39 2 126 2 MSRB4 Peptide methionine sulfoxide reductase B4 Arabidopsis thaliana
Q6AUK5 1.11e-22 92 43 3 125 2 MSRB3 Peptide methionine sulfoxide reductase B3, chloroplastic Oryza sativa subsp. japonica
O49707 2.02e-22 89 39 4 129 2 MSRB8 Peptide methionine sulfoxide reductase B8 Arabidopsis thaliana
Q8VY86 9.95e-22 87 39 4 128 2 MSRB7 Peptide methionine sulfoxide reductase B7 Arabidopsis thaliana
Q8GWF4 1.1e-21 87 37 3 115 2 MSRB6 Peptide methionine sulfoxide reductase B6 Arabidopsis thaliana
Q802G6 1.29e-10 57 35 4 99 2 msrb1 Methionine-R-sulfoxide reductase B1-A Danio rerio
Q5R869 1.54e-10 57 35 3 98 3 MSRB1 Methionine-R-sulfoxide reductase B1 Pongo abelii
Q9NZV6 1.92e-10 57 35 3 98 1 MSRB1 Methionine-R-sulfoxide reductase B1 Homo sapiens
Q52KJ8 2.08e-09 54 34 3 98 3 Msrb1 Methionine-R-sulfoxide reductase B1 Rattus norvegicus
Q3MHL9 3.17e-09 54 35 5 108 3 MSRB1 Methionine-R-sulfoxide reductase B1 Bos taurus
A1E952 8.87e-09 53 35 4 99 3 MSRB1 Methionine-R-sulfoxide reductase B1 Sus scrofa
Q9JLC3 3.22e-08 51 31 3 108 1 Msrb1 Methionine-R-sulfoxide reductase B1 Mus musculus

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12360
Feature type CDS
Gene msrB
Product Peptide methionine sulfoxide reductase MsrB
Location 86079 - 86492 (strand: 1)
Length 414 (nucleotides) / 137 (amino acids)
In genomic island -

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1050
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01641 SelR domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0229 Posttranslational modification, protein turnover, chaperones (O) O Peptide methionine sulfoxide reductase MsrB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07305 peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12] - -

Protein Sequence

MSGTDKKRDTPAELTEIQRYVTQEAGTEHPFTGRLLYNEKQGVYRCICCGSPLFYSDTKFDAGCGWPSFYEPVSKSAVRYIDDTSHGMHRIETRCGHCDAHLGHVFPDGPAPTGQRYCINSASLSFEDEKTKAITNG

Flanking regions ( +/- flanking 50bp)

GTTATTCTGTATTCTGACTGACCCTGCACAATAATGATAAGGATTCAGCTATGTCCGGGACTGATAAAAAGCGGGATACACCCGCTGAGCTGACAGAGATTCAGCGCTATGTCACACAGGAAGCGGGAACTGAGCACCCGTTTACCGGCCGCCTGCTCTATAATGAGAAACAGGGGGTATACCGTTGTATTTGTTGTGGTTCTCCGCTTTTTTATTCGGATACCAAGTTTGATGCCGGCTGCGGCTGGCCGAGTTTTTATGAGCCGGTCAGCAAAAGTGCAGTCCGGTATATTGACGATACCTCTCATGGCATGCATCGTATTGAGACCCGTTGCGGCCATTGTGATGCGCATCTGGGACATGTTTTTCCTGACGGGCCTGCGCCGACAGGGCAGCGTTATTGTATTAACTCAGCATCACTGAGTTTTGAAGATGAAAAAACAAAAGCAATAACAAACGGTTAGTTTGGTTATATTGAAATTTAACATTTATATAACGATAGAAAAAACGATTC