Homologs in group_1050

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05430 FBDBKF_05430 92.5 Morganella morganii S1 msrB Peptide methionine sulfoxide reductase MsrB
EHELCC_12160 EHELCC_12160 92.5 Morganella morganii S2 msrB Peptide methionine sulfoxide reductase MsrB
NLDBIP_12500 NLDBIP_12500 92.5 Morganella morganii S4 msrB Peptide methionine sulfoxide reductase MsrB
LHKJJB_12360 LHKJJB_12360 92.5 Morganella morganii S3 msrB Peptide methionine sulfoxide reductase MsrB
HKOGLL_10975 HKOGLL_10975 92.5 Morganella morganii S5 msrB Peptide methionine sulfoxide reductase MsrB
PMI_RS07285 PMI_RS07285 64.7 Proteus mirabilis HI4320 msrB peptide-methionine (R)-S-oxide reductase MsrB

Distribution of the homologs in the orthogroup group_1050

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1050

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JLG2 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66AP6 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TJB4 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis (strain Pestoides F)
Q1CJ76 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R9C4 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEK7 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis
B2K3R4 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C7U0 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FI81 9.99e-67 201 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GFD8 3.26e-66 199 67 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Serratia proteamaculans (strain 568)
A9MFH4 5.71e-66 199 66 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P65449 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65450 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella typhi
B4TUA8 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella schwarzengrund (strain CVM19633)
A9N292 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3Y1 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella newport (strain SL254)
B4TGC8 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella heidelberg (strain SL476)
B5FJF9 1.63e-65 198 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella dublin (strain CT_02021853)
Q7N400 2.59e-65 197 68 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5F860 3.05e-65 197 66 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Salmonella agona (strain SL483)
A6T7R0 5.4e-65 196 68 0 129 3 msrB Peptide methionine sulfoxide reductase MsrB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XS71 7.34e-65 196 68 0 129 3 msrB Peptide methionine sulfoxide reductase MsrB Klebsiella pneumoniae (strain 342)
B7LQ21 4.94e-64 194 66 0 127 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A1JQG8 1.2e-63 193 63 0 133 3 msrB Peptide methionine sulfoxide reductase MsrB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83L66 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella flexneri
Q0T4Y5 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella flexneri serotype 5b (strain 8401)
Q321R4 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella boydii serotype 4 (strain Sb227)
B1IPF3 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0X0 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O9:H4 (strain HS)
B7M1J2 1.56e-63 193 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O8 (strain IAI1)
Q3Z2B6 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella sonnei (strain Ss046)
B1LDV3 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain SMS-3-5 / SECEC)
B6IBJ9 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain SE11)
B7N5B4 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A746 2.98e-63 192 65 0 132 1 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12)
P0A747 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH50 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XGN8 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12 / DH10B)
C4ZZD4 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain K12 / MC4100 / BW2952)
B7NSZ8 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ71 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A748 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O157:H7
B7L6Q3 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli (strain 55989 / EAEC)
B7USF8 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMP8 2.98e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32GC7 4.19e-63 192 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Shigella dysenteriae serotype 1 (strain Sd197)
B7MVQ9 4.99e-63 191 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O81 (strain ED1a)
B7MAY9 7.33e-63 191 65 0 132 3 msrB Peptide methionine sulfoxide reductase MsrB Escherichia coli O45:K1 (strain S88 / ExPEC)
B2VJ36 4.72e-61 186 67 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DGV8 1.64e-59 182 64 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4P7 1.53e-58 180 62 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9CMB1 1.53e-54 170 57 0 129 3 msrB Peptide methionine sulfoxide reductase MsrB Pasteurella multocida (strain Pm70)
B4RUW0 1.93e-49 157 56 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8D849 2e-49 157 52 0 128 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio vulnificus (strain CMCP6)
Q87MS5 3.81e-49 157 56 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MMC4 4.48e-49 157 52 0 128 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio vulnificus (strain YJ016)
Q8XYL1 1.13e-47 152 57 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5R930 1.83e-47 154 55 0 122 2 MSRB3 Methionine-R-sulfoxide reductase B3 Pongo abelii
Q8IXL7 6.65e-47 152 54 0 122 1 MSRB3 Methionine-R-sulfoxide reductase B3 Homo sapiens
Q8BU85 7.7e-47 154 53 0 129 1 Msrb3 Methionine-R-sulfoxide reductase B3, mitochondrial Mus musculus
C3LNU9 1.88e-46 150 55 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain M66-2)
Q9KQK0 1.88e-46 150 55 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6R2 1.88e-46 150 55 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q92RA4 2.7e-46 149 56 0 123 3 msrB1 Peptide methionine sulfoxide reductase MsrB 1 Rhizobium meliloti (strain 1021)
B8GMG5 6.6e-46 148 61 0 107 3 msrB Peptide methionine sulfoxide reductase MsrB Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A5GQT3 7.45e-46 148 56 0 124 3 msrB Peptide methionine sulfoxide reductase MsrB Synechococcus sp. (strain RCC307)
Q8UGX7 7.47e-46 148 55 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Agrobacterium fabrum (strain C58 / ATCC 33970)
C1DRM1 1.67e-45 147 57 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q46EH1 2.77e-45 147 54 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Methanosarcina barkeri (strain Fusaro / DSM 804)
Q12AE4 3.48e-45 146 62 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6V3R3 4.77e-45 146 56 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain PA7)
Q9I016 4.93e-45 146 53 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NZ0 4.93e-45 146 53 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UUZ9 4.93e-45 146 53 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas aeruginosa (strain LESB58)
B1J4W5 7.06e-45 145 56 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain W619)
A2SGN7 7.22e-45 145 54 0 123 3 msrB Peptide methionine sulfoxide reductase MsrB Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1ID16 1.15e-44 145 55 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas entomophila (strain L48)
A1VNB7 1.68e-44 144 61 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Polaromonas naphthalenivorans (strain CJ2)
C3K735 1.72e-44 144 58 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain SBW25)
Q2SJP9 2.56e-44 144 56 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Hahella chejuensis (strain KCTC 2396)
Q48FR2 4.22e-44 143 54 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8DJK9 5.49e-44 143 55 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3K935 9.79e-44 142 54 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain Pf0-1)
Q0A706 1.08e-43 142 52 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q4K8U5 1.08e-43 142 56 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PWF5 1.52e-43 142 54 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q4ZQC6 1.75e-43 142 56 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas syringae pv. syringae (strain B728a)
A4XVB1 2.13e-43 142 55 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas mendocina (strain ymp)
B0KUQ0 2.35e-43 141 53 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain GB-1)
Q1QXV3 6.39e-43 140 56 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C5CNS9 1.22e-42 140 60 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Variovorax paradoxus (strain S110)
Q885Q1 1.94e-42 139 55 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88LQ6 1.96e-42 139 53 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A9AJS6 2.67e-42 139 53 1 123 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia multivorans (strain ATCC 17616 / 249)
C5BR54 3.17e-42 139 51 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4JEZ1 5.87e-42 138 51 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q39FG2 6.83e-42 138 52 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1YRN6 7.62e-42 138 51 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia ambifaria (strain MC40-6)
B4EBK9 8.5e-42 138 51 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B3PK10 8.57e-42 138 51 1 133 3 msrB Peptide methionine sulfoxide reductase MsrB Cellvibrio japonicus (strain Ueda107)
B1JTT6 9.28e-42 138 51 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia orbicola (strain MC0-3)
Q0BEH0 1.39e-41 137 51 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A5W756 2.82e-41 136 52 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q47EU6 2.91e-41 136 55 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Dechloromonas aromatica (strain RCB)
Q8F7W8 2.95e-41 136 53 0 117 3 msrB Peptide methionine sulfoxide reductase MsrB Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NN2 2.95e-41 136 53 0 117 3 msrB Peptide methionine sulfoxide reductase MsrB Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A4G5V5 4.03e-41 136 50 0 122 3 msrB Peptide methionine sulfoxide reductase MsrB Herminiimonas arsenicoxydans
Q3SJU1 5.42e-41 135 52 0 119 3 msrB Peptide methionine sulfoxide reductase MsrB Thiobacillus denitrificans (strain ATCC 25259)
Q6FAL8 5.5e-41 136 51 1 128 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O26807 5.57e-41 136 54 0 122 1 msrB Peptide methionine sulfoxide reductase MsrB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q1BH71 7e-41 135 51 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia orbicola (strain AU 1054)
A0K833 7e-41 135 51 1 126 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia cenocepacia (strain HI2424)
Q9C8M2 2.51e-40 136 50 0 123 1 MSRB1 Peptide methionine sulfoxide reductase B1, chloroplastic Arabidopsis thaliana
Q5WH73 3.88e-40 134 52 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Shouchella clausii (strain KSM-K16)
Q0DC89 5.96e-40 135 50 1 128 1 MSRB1 Peptide methionine sulfoxide reductase B1, chloroplastic Oryza sativa subsp. japonica
Q78J03 1.05e-39 134 49 1 133 1 Msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Mus musculus
Q21LK2 1.05e-39 132 53 0 110 3 msrB Peptide methionine sulfoxide reductase MsrB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6ADJ8 2.19e-39 132 52 1 123 3 msrB Peptide methionine sulfoxide reductase MsrB Leifsonia xyli subsp. xyli (strain CTCB07)
Q4FZX5 3.02e-39 132 49 1 133 2 Msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Rattus norvegicus
Q2SWN9 3.77e-39 131 51 1 123 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9Y3D2 4.19e-39 132 48 1 133 1 MSRB2 Methionine-R-sulfoxide reductase B2, mitochondrial Homo sapiens
Q63V23 4.21e-39 131 50 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia pseudomallei (strain K96243)
A1V4U8 4.21e-39 131 50 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain SAVP1)
Q62JM6 4.21e-39 131 50 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain ATCC 23344)
A2SBI6 4.21e-39 131 50 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia mallei (strain NCTC 10229)
Q3JRF0 1.41e-38 130 49 1 127 1 msrB Peptide methionine sulfoxide reductase MsrB Burkholderia pseudomallei (strain 1710b)
Q87AJ9 1.42e-38 130 52 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8Y4 1.42e-38 130 52 0 109 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain M23)
Q89EM9 1.68e-38 129 52 0 116 3 msrB Peptide methionine sulfoxide reductase MsrB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P34436 2.08e-38 130 54 2 124 3 F44E2.6 Probable methionine-R-sulfoxide reductase B Caenorhabditis elegans
Q9KCX2 2.44e-38 129 51 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B8GY23 3.62e-38 129 54 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A6B1 3.62e-38 129 54 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B1HZH4 9.36e-38 128 47 1 130 3 msrB Peptide methionine sulfoxide reductase MsrB Lysinibacillus sphaericus (strain C3-41)
Q9PF29 2.79e-37 127 52 0 106 3 msrB Peptide methionine sulfoxide reductase MsrB Xylella fastidiosa (strain 9a5c)
B0VR86 2.82e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain SDF)
Q71YF7 3.11e-37 126 50 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4b (strain F2365)
C1KWF8 3.11e-37 126 50 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4b (strain CLIP80459)
B0VC45 3.21e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AYE)
A3M4Q3 3.21e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HYT2 3.21e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain ACICU)
B7I415 3.21e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AB0057)
B7H3X2 3.21e-37 126 46 0 125 3 msrB Peptide methionine sulfoxide reductase MsrB Acinetobacter baumannii (strain AB307-0294)
Q8Y641 4.27e-37 126 50 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P65448 4.96e-37 126 49 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Brucella suis biovar 1 (strain 1330)
P65447 4.96e-37 126 49 1 127 3 msrB Peptide methionine sulfoxide reductase MsrB Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q92Y46 6.64e-37 125 50 1 126 3 msrB2 Peptide methionine sulfoxide reductase MsrB 2 Rhizobium meliloti (strain 1021)
B0BYW4 8.41e-37 125 51 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Acaryochloris marina (strain MBIC 11017)
Q6NW52 1.37e-36 126 49 1 130 2 msrb2 Methionine-R-sulfoxide reductase B2, mitochondrial Danio rerio
A0AJW4 1.71e-36 124 49 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
E6ESW1 2.98e-36 124 51 1 119 1 msrB Peptide methionine sulfoxide reductase MsrB Enterococcus faecalis (strain TX4000 / JH2-2)
P0DM32 2.98e-36 124 51 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Enterococcus faecalis (strain ATCC 700802 / V583)
B8DDP3 3.87e-36 124 49 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria monocytogenes serotype 4a (strain HCC23)
Q65ID2 1.43e-35 122 51 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9ZNJ9 2.42e-35 122 50 2 121 3 msrB Peptide methionine sulfoxide reductase MsrB Hathewaya histolytica
Q92AE9 2.7e-35 122 49 1 120 3 msrB Peptide methionine sulfoxide reductase MsrB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A8FEA3 3.85e-35 121 50 0 113 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus pumilus (strain SAFR-032)
A7Z5S1 1.26e-34 120 48 0 118 3 msrB Peptide methionine sulfoxide reductase MsrB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8INK9 1.4e-34 122 46 2 134 1 SelR Methionine-R-sulfoxide reductase B1 Drosophila melanogaster
P54155 1.18e-33 117 48 2 126 1 msrB Peptide methionine sulfoxide reductase MsrB Bacillus subtilis (strain 168)
P0A3R0 1.27e-33 122 50 1 124 1 msrAB1 Peptide methionine sulfoxide reductase MsrA/MsrB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Q9 1.27e-33 122 50 1 124 1 msrAB1 Peptide methionine sulfoxide reductase MsrA/MsrB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9LAM9 1.53e-33 122 46 1 127 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q97IU0 2.17e-33 117 49 1 121 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P47686 2.23e-33 117 48 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q93KF3 5.66e-33 121 48 1 122 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Campylobacter fetus
Q8XJZ6 3.36e-32 114 50 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain 13 / Type A)
Q0TPZ6 3.36e-32 114 50 1 115 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SSL4 4.37e-32 114 50 1 114 3 msrB Peptide methionine sulfoxide reductase MsrB Clostridium perfringens (strain SM101 / Type A)
Q72EK2 1.04e-31 112 48 0 121 3 msrB Peptide methionine sulfoxide reductase MsrB Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P75129 1.16e-31 112 47 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q88W33 3.35e-31 111 47 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9KLX6 6.99e-31 116 45 0 125 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9RUK6 1.2e-30 110 46 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8E026 1.52e-30 109 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5Q9 1.52e-30 109 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype III (strain NEM316)
Q3K1F5 1.52e-30 109 49 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q99ZV6 3.28e-30 108 45 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M1
Q8P172 6.8e-30 108 45 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCD0 7.75e-30 107 45 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q1WVT3 1.27e-29 107 45 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Ligilactobacillus salivarius (strain UCC118)
B9DNY9 1.43e-29 107 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus carnosus (strain TM300)
Q2YY44 1.65e-29 107 47 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0DC43 2.62e-29 106 44 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC42 2.62e-29 106 44 1 119 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P25566 2.76e-29 107 45 1 121 1 MXR2 Peptide methionine sulfoxide reductase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9AL99 6.45e-29 110 45 1 122 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Aggregatibacter actinomycetemcomitans
P86890 8.38e-29 110 48 1 117 1 msrAB Peptide methionine sulfoxide reductase msrA/msrB Enterococcus faecalis
P0DC41 9.89e-29 109 44 1 129 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC40 9.89e-29 109 44 1 129 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8P046 1.18e-28 109 44 1 129 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8CSK6 1.19e-28 104 43 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB4 1.19e-28 104 43 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5XAX5 1.21e-28 109 44 1 129 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99YT1 1.21e-28 109 44 1 129 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Streptococcus pyogenes serotype M1
P45213 2.06e-28 109 46 1 122 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P65444 2.98e-28 108 44 1 129 3 msrAB2 Peptide methionine sulfoxide reductase MsrA/MsrB 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65443 2.98e-28 108 44 1 129 3 msrAB2 Peptide methionine sulfoxide reductase MsrA/MsrB 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q032Q9 3.5e-28 103 47 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. cremoris (strain SK11)
O25011 3.52e-28 108 47 1 117 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZMK8 3.67e-28 108 47 1 117 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Helicobacter pylori (strain J99 / ATCC 700824)
P0A087 3.77e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MW2)
A8Z402 3.77e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9D8 3.77e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MSSA476)
A6QGX4 3.77e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Newman)
P0A088 3.77e-28 103 45 1 117 1 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH15 3.77e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain USA300)
C0M8H8 3.97e-28 103 42 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus equi subsp. equi (strain 4047)
Q6GGY4 4.59e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain MRSA252)
P99065 4.59e-28 103 45 1 117 1 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain N315)
P65451 4.59e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISV4 4.59e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain JH9)
A6U1P3 4.59e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain JH1)
A7X2A9 4.59e-28 103 45 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9Y7K1 5.16e-28 103 38 3 131 3 SPBC216.04c Uncharacterized protein C216.04c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4L6D3 5.52e-28 103 42 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus haemolyticus (strain JCSC1435)
C0MDV8 1.37e-27 102 42 1 122 3 msrB Peptide methionine sulfoxide reductase MsrB Streptococcus equi subsp. zooepidemicus (strain H70)
O83641 2.66e-27 105 45 1 114 3 msrAB Peptide methionine sulfoxide reductase MsrB/MsrA Treponema pallidum (strain Nichols)
Q49XN4 4.35e-27 100 41 1 117 3 msrB Peptide methionine sulfoxide reductase MsrB Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9CJ17 5.18e-27 100 45 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. lactis (strain IL1403)
A2RHS0 5.77e-27 100 46 1 107 3 msrB Peptide methionine sulfoxide reductase MsrB Lactococcus lactis subsp. cremoris (strain MG1363)
Q9M0Z6 8.53e-27 101 42 3 120 2 MSRB3 Peptide methionine sulfoxide reductase B3 Arabidopsis thaliana
Q9K1N8 9.72e-27 106 45 1 122 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JWM8 9.72e-27 106 45 1 122 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P14930 2.05e-26 105 45 1 122 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria gonorrhoeae
Q9ZS91 1.03e-24 94 38 2 128 1 MSRB5 Peptide methionine sulfoxide reductase B5 Arabidopsis thaliana
Q9C5C8 1.34e-23 93 40 2 120 1 MSRB2 Peptide methionine sulfoxide reductase B2, chloroplastic Arabidopsis thaliana
Q84JT6 6.74e-23 90 40 3 120 2 MSRB9 Peptide methionine sulfoxide reductase B9 Arabidopsis thaliana
Q9M0Z5 9.99e-23 89 37 2 129 2 MSRB4 Peptide methionine sulfoxide reductase B4 Arabidopsis thaliana
Q8GWF4 2.71e-22 89 35 3 130 2 MSRB6 Peptide methionine sulfoxide reductase B6 Arabidopsis thaliana
Q10L32 7.23e-22 87 39 2 120 2 MSRB5 Peptide methionine sulfoxide reductase B5 Oryza sativa subsp. japonica
O49707 2.08e-21 86 38 3 120 2 MSRB8 Peptide methionine sulfoxide reductase B8 Arabidopsis thaliana
Q8VY86 2.38e-21 86 38 3 120 2 MSRB7 Peptide methionine sulfoxide reductase B7 Arabidopsis thaliana
Q6AUK5 2.79e-21 88 40 3 128 2 MSRB3 Peptide methionine sulfoxide reductase B3, chloroplastic Oryza sativa subsp. japonica
Q5R869 1.48e-09 55 32 3 101 3 MSRB1 Methionine-R-sulfoxide reductase B1 Pongo abelii
Q802G6 1.63e-09 55 32 4 106 2 msrb1 Methionine-R-sulfoxide reductase B1-A Danio rerio
Q9NZV6 1.91e-09 54 32 3 101 1 MSRB1 Methionine-R-sulfoxide reductase B1 Homo sapiens
Q52KJ8 3.38e-08 51 31 3 101 3 Msrb1 Methionine-R-sulfoxide reductase B1 Rattus norvegicus
Q9JLC3 3.6e-08 51 31 3 101 1 Msrb1 Methionine-R-sulfoxide reductase B1 Mus musculus
Q3MHL9 5.27e-08 51 33 4 102 3 MSRB1 Methionine-R-sulfoxide reductase B1 Bos taurus
A1E952 9.72e-08 50 33 4 102 3 MSRB1 Methionine-R-sulfoxide reductase B1 Sus scrofa

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03865
Feature type CDS
Gene msrB
Product peptide-methionine (R)-S-oxide reductase MsrB
Location 819383 - 819784 (strand: 1)
Length 402 (nucleotides) / 133 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1050
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01641 SelR domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0229 Posttranslational modification, protein turnover, chaperones (O) O Peptide methionine sulfoxide reductase MsrB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07305 peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12] - -

Protein Sequence

MSGTEKKPALTDIQRYVTQEAGTEHPFTGRLLYNEDQGVYRCICCDSPVFYSDTKFDAGCGWPSFYEPVSKSAIRYIDDSSHGMHRIETRCGHCDAHLGHVFPDGPAPTGQRYCINSASLSFEDKKTKEITKG

Flanking regions ( +/- flanking 50bp)

TTACCCTTATACTTTAGTTTGGGTTACAGAATAATGATAAGGATTCAGCAATGTCCGGGACTGAAAAAAAACCTGCACTGACAGATATTCAGCGCTACGTCACACAGGAGGCAGGAACAGAGCATCCGTTTACCGGCCGCCTGCTATATAATGAAGACCAGGGTGTATATCGTTGTATTTGCTGCGATTCCCCTGTTTTTTATTCTGATACTAAATTTGATGCAGGCTGCGGCTGGCCAAGTTTTTATGAACCTGTCAGCAAAAGTGCGATCCGGTATATTGACGACAGCTCTCATGGCATGCATCGTATTGAGACCCGCTGTGGGCATTGTGATGCGCATCTCGGGCACGTTTTTCCTGACGGACCTGCGCCGACAGGGCAGCGGTATTGCATTAACTCAGCATCACTGAGTTTTGAAGATAAAAAAACAAAAGAAATAACAAAAGGTTAGTCTGTTAAGTTTTCAATTTAACATTTAATCAACCAAAGAAAAAACGATTC