Homologs in group_3652

Help

3 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05545 FBDBKF_05545 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
FBDBKF_19670 FBDBKF_19670 37.2 Morganella morganii S1 - XRE family transcriptional regulator
NLDBIP_12385 NLDBIP_12385 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain

Distribution of the homologs in the orthogroup group_3652

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3652

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q97QZ2 7.12e-06 45 37 0 56 1 pezA Antitoxin PezA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9ZD50 0.000316 41 33 0 54 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q92HV3 0.001 39 31 0 54 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12245
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 62900 - 63277 (strand: -1)
Length 378 (nucleotides) / 125 (amino acids)

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3652
Orthogroup size 4
N. genomes 3

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MQPDNCHALSCQHQVFKKELHAVIGQEIRTLRKSKGITGHELGSIIQLSQQQISRYENGDSAIPLDTLILILRIFNISPEKFIHRVLFILNRDPNSKKLLSHMSNHLNSYTDGSYLGTFEQYKHN

Flanking regions ( +/- flanking 50bp)

ATAGTATTTAAAATATACATTAAGTTTAATGACGTCCTGATGGTATCTTTATGCAGCCCGATAATTGCCACGCACTTAGTTGTCAACACCAGGTCTTTAAAAAGGAGCTTCATGCAGTTATAGGCCAGGAAATTAGAACATTACGAAAATCAAAAGGTATCACCGGCCATGAATTAGGTTCAATAATACAGCTATCGCAGCAGCAGATATCCCGTTACGAGAATGGTGACAGTGCTATTCCGCTGGATACACTGATATTAATACTGCGTATTTTTAATATATCGCCGGAAAAATTTATACACAGAGTGTTATTTATCTTAAACAGAGATCCTAATTCAAAAAAACTATTATCCCATATGTCGAATCATCTTAATTCTTATACTGACGGCAGTTATCTGGGAACATTTGAACAATATAAACACAATTAACATAATTACTATATTTAAGATTACACACAGCTTTTAATTTAAGGGCATAG