Homologs in group_1251

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06895 FBDBKF_06895 100.0 Morganella morganii S1 hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
EHELCC_04075 EHELCC_04075 100.0 Morganella morganii S2 hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
NLDBIP_04075 NLDBIP_04075 100.0 Morganella morganii S4 hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
HKOGLL_09070 HKOGLL_09070 100.0 Morganella morganii S5 hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
F4V73_RS01080 F4V73_RS01080 92.1 Morganella psychrotolerans hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
PMI_RS03240 PMI_RS03240 68.3 Proteus mirabilis HI4320 hisIE bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE

Distribution of the homologs in the orthogroup group_1251

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1251

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N6I6 2.45e-110 317 71 0 201 3 hisI Histidine biosynthesis bifunctional protein HisIE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P06989 4.11e-103 298 68 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Escherichia coli (strain K12)
Q8ZFY1 3.17e-98 286 70 0 202 3 hisI Histidine biosynthesis bifunctional protein HisIE Yersinia pestis
O24714 3.7e-98 286 67 1 202 3 hisI Histidine biosynthesis bifunctional protein HisIE Klebsiella pneumoniae
Q3Z0F9 1.98e-95 279 69 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Shigella sonnei (strain Ss046)
Q9S5G3 1.98e-95 279 69 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Escherichia coli O157:H7
P10367 2.81e-95 278 69 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FG47 3.73e-94 276 68 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z5J6 6.96e-94 275 68 0 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Salmonella typhi
Q9CLL8 1.05e-93 275 67 1 198 3 hisI Histidine biosynthesis bifunctional protein HisIE Pasteurella multocida (strain Pm70)
P37793 6.15e-93 273 68 0 203 1 hisI Histidine biosynthesis bifunctional protein HisIE Shigella flexneri
Q9PM71 3.11e-84 251 59 1 197 3 hisI Histidine biosynthesis bifunctional protein HisIE Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P62349 4.09e-84 250 59 1 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Photobacterium profundum (strain SS9)
P44434 1.68e-82 247 57 1 208 3 hisI Histidine biosynthesis bifunctional protein HisIE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7MLS0 3.4e-82 246 61 2 198 3 hisI Histidine biosynthesis bifunctional protein HisIE Vibrio vulnificus (strain YJ016)
Q87QK5 4.57e-82 245 60 1 198 3 hisI Histidine biosynthesis bifunctional protein HisIE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KSW7 2.11e-81 244 60 1 198 3 hisI Histidine biosynthesis bifunctional protein HisIE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8D8Q6 2.39e-80 241 60 2 198 3 hisI Histidine biosynthesis bifunctional protein HisIE Vibrio vulnificus (strain CMCP6)
Q8EFB6 2.12e-77 233 56 1 201 3 hisI Histidine biosynthesis bifunctional protein HisIE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P57207 1.34e-74 226 53 0 201 3 hisI Histidine biosynthesis bifunctional protein HisIE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q7VQW4 8.4e-74 224 51 1 208 3 hisI Histidine biosynthesis bifunctional protein HisIE Blochmanniella floridana
Q9ZHE0 2.59e-73 223 53 1 202 3 hisI Histidine biosynthesis bifunctional protein HisIE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8P9N8 1.57e-66 206 56 2 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87C35 5.04e-66 204 55 2 197 3 hisI Histidine biosynthesis bifunctional protein HisIE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PBD1 1e-65 204 55 2 197 3 hisI Histidine biosynthesis bifunctional protein HisIE Xylella fastidiosa (strain 9a5c)
Q8PLG5 7.22e-65 201 54 2 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Xanthomonas axonopodis pv. citri (strain 306)
Q89AX6 2.9e-61 192 50 0 201 3 hisI Histidine biosynthesis bifunctional protein HisIE Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5HKP3 1.65e-57 183 45 0 186 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQ91 3.77e-57 182 45 0 186 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8A7Z7 8.37e-57 181 45 1 195 3 hisI Histidine biosynthesis bifunctional protein HisIE Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8NUI4 3.7e-50 164 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain MW2)
Q6G603 3.7e-50 164 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain MSSA476)
Q6GDD2 3.7e-50 164 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain MRSA252)
Q5HCM5 3.7e-50 164 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain COL)
P64356 1.21e-49 163 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain N315)
P64355 1.21e-49 163 43 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Staphylococcus aureus (strain Mu50 / ATCC 700699)
O34912 2.18e-47 157 47 1 191 3 hisI Histidine biosynthesis bifunctional protein HisIE Bacillus subtilis (strain 168)
Q7MAQ8 1.4e-45 153 42 3 191 3 hisI Histidine biosynthesis bifunctional protein HisIE Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q02130 2.66e-45 152 42 2 191 3 hisI Histidine biosynthesis bifunctional protein HisIE Lactococcus lactis subsp. lactis (strain IL1403)
Q8CXM8 2.66e-43 147 39 2 201 3 hisI Histidine biosynthesis bifunctional protein HisIE Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8R886 9.6e-43 145 37 3 203 3 hisI Histidine biosynthesis bifunctional protein HisIE Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P58853 1.27e-42 145 41 4 213 3 hisI Histidine biosynthesis bifunctional protein HisIE Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9RWD6 4.06e-42 144 38 2 204 3 hisI Histidine biosynthesis bifunctional protein HisIE Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8YS28 1.05e-41 143 39 3 196 3 hisI Histidine biosynthesis bifunctional protein HisIE Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9K6Z7 1.78e-40 139 42 1 195 3 hisI Histidine biosynthesis bifunctional protein HisIE Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9X0C5 3.58e-40 138 36 2 194 3 hisI Histidine biosynthesis bifunctional protein HisIE Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P62350 6.37e-40 138 42 2 163 3 hisI Histidine biosynthesis bifunctional protein HisIE Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q7NLB5 1.07e-39 138 40 4 197 3 hisI Histidine biosynthesis bifunctional protein HisIE Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P74755 3.38e-39 136 40 2 192 3 hisI Histidine biosynthesis bifunctional protein HisIE Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7VJ02 3.78e-39 137 34 3 212 3 hisI Histidine biosynthesis bifunctional protein HisIE Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8DM88 6.49e-39 135 39 3 199 3 hisI Histidine biosynthesis bifunctional protein HisIE Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
O82768 7.04e-38 135 37 6 216 1 HISN2 Histidine biosynthesis bifunctional protein hisIE, chloroplastic Arabidopsis thaliana
Q9RPQ3 3.34e-37 131 34 3 216 3 hisI Histidine biosynthesis bifunctional protein HisIE Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q7VD07 1.79e-36 130 32 4 221 3 hisI Histidine biosynthesis bifunctional protein HisIE Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
O67780 8.42e-36 127 34 4 204 3 hisI Histidine biosynthesis bifunctional protein HisIE Aquifex aeolicus (strain VF5)
Q7TV28 4.87e-35 126 37 4 213 3 hisI Histidine biosynthesis bifunctional protein HisIE Prochlorococcus marinus (strain MIT 9313)
Q7U635 8.55e-33 120 34 4 208 3 hisI Histidine biosynthesis bifunctional protein HisIE Parasynechococcus marenigrum (strain WH8102)
Q7TUC7 2.66e-31 116 33 4 209 3 hisI Histidine biosynthesis bifunctional protein HisIE Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
C1FN43 1.01e-30 111 49 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain Kyoto / Type A2)
A5I247 8.19e-30 109 47 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU83 8.19e-30 109 47 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain ATCC 19397 / Type A)
A8ZXG8 1.06e-29 109 43 2 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q0A9D7 1.57e-28 107 51 1 99 3 hisI Phosphoribosyl-AMP cyclohydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B1ILB1 3.6e-28 105 46 0 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain Okra / Type B1)
A6LT23 4.39e-28 104 42 0 101 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q63Q93 5.53e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia pseudomallei (strain K96243)
A3NE92 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia pseudomallei (strain 668)
Q3JN03 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia pseudomallei (strain 1710b)
A3P026 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia pseudomallei (strain 1106a)
A1V8H6 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia mallei (strain SAVP1)
Q62GE6 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia mallei (strain ATCC 23344)
A2S755 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia mallei (strain NCTC 10229)
A3MPU3 5.62e-28 105 43 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia mallei (strain NCTC 10247)
B2UX19 1.37e-27 103 42 0 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain Alaska E43 / Type E3)
C3KVX7 1.45e-27 103 46 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium botulinum (strain 657 / Type Ba4)
Q8DTR4 1.66e-27 103 47 0 96 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B9MDW4 1.82e-27 103 42 4 138 3 hisI Phosphoribosyl-AMP cyclohydrolase Acidovorax ebreus (strain TPSY)
C1EMQ8 2.66e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain 03BB102)
A0RBM3 2.66e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus thuringiensis (strain Al Hakam)
Q6HLE2 4.57e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DW7 4.57e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain ZK / E33L)
A1W445 5.29e-27 102 42 4 138 3 hisI Phosphoribosyl-AMP cyclohydrolase Acidovorax sp. (strain JS42)
B7JFZ6 5.32e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain AH820)
P60540 5.32e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus anthracis
C3L9P6 5.32e-27 102 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus anthracis (strain CDC 684 / NRRL 3495)
B2UEE4 5.5e-27 103 37 4 140 3 hisI Phosphoribosyl-AMP cyclohydrolase Ralstonia pickettii (strain 12J)
A1KAV3 6.11e-27 102 40 3 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Azoarcus sp. (strain BH72)
Q97KH7 7.03e-27 102 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9A5W9 9.47e-27 101 42 0 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrosopumilus maritimus (strain SCM1)
P62393 1.42e-26 100 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain ATCC 10987 / NRS 248)
A2SE10 2.1e-26 101 42 5 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B4S4Y9 2.26e-26 101 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q1GGT9 2.29e-26 101 48 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Ruegeria sp. (strain TM1040)
Q5LST2 2.42e-26 100 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B7HHG6 2.6e-26 100 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain B4264)
B7INA4 2.6e-26 100 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain G9842)
B8FLE7 2.8e-26 100 46 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Desulfatibacillum aliphaticivorans
Q2LVG1 3.01e-26 100 37 1 124 3 hisI Phosphoribosyl-AMP cyclohydrolase Syntrophus aciditrophicus (strain SB)
B7HKD5 3.37e-26 99 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain AH187)
Q1LIB3 3.47e-26 100 39 4 140 3 hisI Phosphoribosyl-AMP cyclohydrolase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q28PE4 3.49e-26 100 42 1 110 3 hisI Phosphoribosyl-AMP cyclohydrolase Jannaschia sp. (strain CCS1)
Q81G01 4.36e-26 99 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C0QLA8 5.76e-26 100 41 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B9IV01 5.78e-26 99 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cereus (strain Q1)
B4E642 5.99e-26 100 40 4 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4JAX0 6.12e-26 100 40 3 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q12FC6 6.45e-26 100 47 2 101 3 hisI Phosphoribosyl-AMP cyclohydrolase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1TL07 7.89e-26 100 41 4 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Paracidovorax citrulli (strain AAC00-1)
Q8XV86 7.93e-26 100 37 4 140 3 hisI Phosphoribosyl-AMP cyclohydrolase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q722Y8 8.85e-26 99 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria monocytogenes serotype 4b (strain F2365)
C1L0J1 8.85e-26 99 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria monocytogenes serotype 4b (strain CLIP80459)
A1B9F2 9.12e-26 99 46 1 103 3 hisI Phosphoribosyl-AMP cyclohydrolase Paracoccus denitrificans (strain Pd 1222)
Q8Y9G6 9.54e-26 99 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B3WED0 1.03e-25 99 44 0 96 3 hisI Phosphoribosyl-AMP cyclohydrolase Lacticaseibacillus casei (strain BL23)
Q5P796 1.07e-25 99 40 2 121 3 hisI Phosphoribosyl-AMP cyclohydrolase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1WXS8 1.1e-25 99 46 2 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Halorhodospira halophila (strain DSM 244 / SL1)
Q166D6 1.33e-25 99 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4WRQ0 1.45e-25 99 46 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B8DA63 1.45e-25 98 48 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria monocytogenes serotype 4a (strain HCC23)
Q465C4 1.49e-25 99 40 1 119 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q0K694 1.51e-25 99 38 4 139 3 hisI Phosphoribosyl-AMP cyclohydrolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q01ZT9 1.7e-25 99 39 2 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Solibacter usitatus (strain Ellin6076)
Q48PJ7 1.71e-25 99 40 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q39K84 1.79e-25 99 40 4 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q039B6 2.12e-25 98 44 0 96 3 hisI Phosphoribosyl-AMP cyclohydrolase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q0BIW3 2.2e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRW2 2.2e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia ambifaria (strain MC40-6)
Q1BS32 2.22e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia orbicola (strain AU 1054)
B1JUA6 2.22e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia orbicola (strain MC0-3)
A0K3V9 2.22e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia cenocepacia (strain HI2424)
Q845U6 2.3e-25 99 46 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Burkholderia multivorans (strain ATCC 17616 / 249)
A8LK58 2.85e-25 98 47 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q46WL9 3.62e-25 98 38 4 140 3 hisI Phosphoribosyl-AMP cyclohydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q87UY9 3.87e-25 98 40 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6AF72 4.09e-25 97 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Leifsonia xyli subsp. xyli (strain CTCB07)
A0RZ79 4.55e-25 97 42 0 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Cenarchaeum symbiosum (strain A)
B3EFT2 5.69e-25 97 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3B281 6.13e-25 97 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P26722 6.33e-25 97 57 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Azospirillum brasilense
A5G0S8 7.61e-25 96 43 0 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Acidiphilium cryptum (strain JF-5)
A1R5S3 7.98e-25 97 45 0 101 3 hisI Phosphoribosyl-AMP cyclohydrolase Paenarthrobacter aurescens (strain TC1)
A5CZ72 9.29e-25 97 40 2 121 3 hisI Phosphoribosyl-AMP cyclohydrolase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q4ZZG6 9.34e-25 97 39 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas syringae pv. syringae (strain B728a)
A5CRW1 9.66e-25 97 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A3PJ78 1.18e-24 96 45 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q970Y6 1.29e-24 96 41 1 108 3 hisI Phosphoribosyl-AMP cyclohydrolase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B3R793 1.36e-24 96 43 2 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4SG83 1.39e-24 96 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B0REU6 1.47e-24 96 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Clavibacter sepedonicus
A7GMV1 1.78e-24 95 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B9KRK6 1.94e-24 95 45 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q7UJC4 2.43e-24 95 48 1 93 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q4KJL5 2.77e-24 95 39 4 129 3 hisI1 Phosphoribosyl-AMP cyclohydrolase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3AT43 2.82e-24 95 43 0 101 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium chlorochromatii (strain CaD3)
Q04Y79 2.88e-24 94 53 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04V97 2.88e-24 94 53 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q1QWC3 3.29e-24 96 47 1 94 3 hisI Phosphoribosyl-AMP cyclohydrolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A8AY23 3.42e-24 95 41 0 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q31J60 3.46e-24 96 40 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q30VD6 3.62e-24 95 45 1 96 3 hisI Phosphoribosyl-AMP cyclohydrolase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1VK43 4.23e-24 95 42 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Polaromonas naphthalenivorans (strain CJ2)
B3EM52 4.52e-24 95 43 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium phaeobacteroides (strain BS1)
Q8PVE6 4.6e-24 95 39 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9S2U1 5.99e-24 94 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4G9I5 6.54e-24 95 39 3 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Herminiimonas arsenicoxydans
A1AVW3 7.99e-24 94 44 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Ruthia magnifica subsp. Calyptogena magnifica
A1SL49 9.22e-24 94 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A5CXC7 9.8e-24 94 42 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B6IMI3 9.99e-24 94 41 1 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q9X3W1 1.01e-23 94 39 1 94 3 hisI Phosphoribosyl-AMP cyclohydrolase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A9BXA2 1.17e-23 94 39 4 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q3J6Q0 1.24e-23 94 40 4 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2RTY3 1.28e-23 94 40 1 120 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q92E89 1.28e-23 93 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q03K83 1.33e-23 93 44 0 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A0JVK7 1.33e-23 94 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Arthrobacter sp. (strain FB24)
Q02EV1 1.36e-23 94 39 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas aeruginosa (strain UCBPP-PA14)
A3CNS9 1.76e-23 93 43 0 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptococcus sanguinis (strain SK36)
Q9HUB7 1.79e-23 94 39 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V3F9 1.79e-23 94 39 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas aeruginosa (strain LESB58)
Q6AJV8 1.84e-23 93 38 4 133 3 hisI Phosphoribosyl-AMP cyclohydrolase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4VGE2 1.94e-23 93 39 4 128 3 hisI Phosphoribosyl-AMP cyclohydrolase Stutzerimonas stutzeri (strain A1501)
Q4JW51 2.05e-23 93 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Corynebacterium jeikeium (strain K411)
A1BDQ9 2.12e-23 93 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
C5CBK2 2.22e-23 93 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A9WR59 2.24e-23 93 47 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q2FPA4 2.46e-23 93 37 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
B4SCX8 2.74e-23 93 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q6A8P2 2.91e-23 93 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q53158 3.2e-23 92 43 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3KJC8 3.25e-23 93 36 3 137 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas fluorescens (strain Pf0-1)
A6VDI9 4.05e-23 92 39 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas aeruginosa (strain PA7)
Q88D15 4.14e-23 92 37 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA48 4.14e-23 92 37 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B3QLJ0 4.39e-23 92 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8TS96 4.44e-23 92 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B0KM39 4.91e-23 92 37 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas putida (strain GB-1)
Q0AEU0 5.15e-23 92 38 4 135 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8KF68 5.32e-23 92 39 2 120 3 hisI Phosphoribosyl-AMP cyclohydrolase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3SEU9 6.39e-23 92 42 2 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Thiobacillus denitrificans (strain ATCC 25259)
Q0RFX5 6.49e-23 92 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5YYP1 6.55e-23 91 40 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Nocardia farcinica (strain IFM 10152)
Q2NAM2 6.73e-23 92 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Erythrobacter litoralis (strain HTCC2594)
A6T375 7.3e-23 92 43 2 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Janthinobacterium sp. (strain Marseille)
Q21U90 7.5e-23 92 45 2 101 3 hisI Phosphoribosyl-AMP cyclohydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1J2S5 7.54e-23 92 37 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas putida (strain W619)
A0AG14 7.8e-23 91 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q18DH0 8.95e-23 92 43 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A1WFT0 1.16e-22 91 40 4 127 3 hisI Phosphoribosyl-AMP cyclohydrolase Verminephrobacter eiseniae (strain EF01-2)
Q12V48 1.24e-22 91 37 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8EXX8 1.3e-22 90 51 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62347 1.3e-22 90 51 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q82WM6 1.32e-22 91 37 4 135 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q4K3E4 1.36e-22 92 45 1 96 3 hisI2 Phosphoribosyl-AMP cyclohydrolase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3IMJ0 1.38e-22 91 43 0 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
B1W0N3 1.49e-22 91 43 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q0VML6 1.53e-22 91 45 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A0LTT2 1.7e-22 91 42 0 92 3 hisI Phosphoribosyl-AMP cyclohydrolase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q88UE4 1.78e-22 90 41 1 104 3 hisI Phosphoribosyl-AMP cyclohydrolase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8G6F6 1.79e-22 91 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bifidobacterium longum (strain NCC 2705)
B3DRT9 1.79e-22 91 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bifidobacterium longum (strain DJO10A)
Q0W7V3 2.09e-22 90 40 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
B7GQS6 2.45e-22 90 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q0BTI5 2.64e-22 90 40 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q2S3T1 2.92e-22 90 39 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Salinibacter ruber (strain DSM 13855 / M31)
A5V9F7 3.42e-22 89 50 0 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q82A89 3.86e-22 90 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q1I3S7 4.1e-22 90 36 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Pseudomonas entomophila (strain L48)
C1ATY6 4.35e-22 89 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodococcus opacus (strain B4)
Q0SHY8 4.59e-22 89 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodococcus jostii (strain RHA1)
Q3M244 4.85e-22 89 44 1 93 3 hisI Phosphoribosyl-AMP cyclohydrolase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A9HWB8 5.3e-22 90 40 4 123 3 hisI Phosphoribosyl-AMP cyclohydrolase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1VHE5 5.3e-22 89 38 2 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitratidesulfovibrio vulgaris (strain DP4)
P62386 5.3e-22 89 38 2 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B2HQA9 5.53e-22 89 43 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium marinum (strain ATCC BAA-535 / M)
C1A0L2 5.6e-22 89 40 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A5G6I6 6.06e-22 89 35 3 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Geotalea uraniireducens (strain Rf4)
A3CX32 6.12e-22 89 37 1 119 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A1A1I6 6.59e-22 89 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q7W2X8 6.77e-22 89 46 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDX8 6.77e-22 89 46 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q39UE8 6.81e-22 89 40 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A1U670 8.2e-22 89 39 5 138 3 hisI Phosphoribosyl-AMP cyclohydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q43925 9.7e-22 89 35 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Azotobacter chroococcum mcd 1
B9M8U6 1.17e-21 89 39 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A7I9M0 1.3e-21 88 36 1 119 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
A5V3S9 1.33e-21 88 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
C6E0X3 1.57e-21 88 34 3 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Geobacter sp. (strain M21)
A0PP21 1.67e-21 88 43 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium ulcerans (strain Agy99)
A8LSV9 1.72e-21 87 51 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2VYJ1 1.86e-21 87 55 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
C1DHS5 1.88e-21 88 35 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B5EE14 2.01e-21 88 38 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q2W4W4 2.25e-21 88 37 3 128 3 hisI Phosphoribosyl-AMP cyclohydrolase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q603K4 2.97e-21 87 38 4 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0B8B3 3.12e-21 87 37 1 119 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
B8GU33 3.21e-21 87 39 4 126 3 hisI Phosphoribosyl-AMP cyclohydrolase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q134L8 3.69e-21 88 36 0 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain BisB5)
B3QU88 3.86e-21 87 43 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q1H4R1 3.96e-21 87 34 3 124 3 hisI Phosphoribosyl-AMP cyclohydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7VSY5 4.35e-21 87 44 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P9WMM7 4.53e-21 87 41 0 91 1 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMM6 4.53e-21 87 41 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U2W2 4.53e-21 87 41 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANM8 4.53e-21 87 41 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ22 4.53e-21 87 41 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5B4 4.53e-21 87 41 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B3PK83 4.96e-21 87 40 2 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Cellvibrio japonicus (strain Ueda107)
B1XX97 5.43e-21 87 39 4 130 3 hisI Phosphoribosyl-AMP cyclohydrolase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4T9N1 5.55e-21 86 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycolicibacterium gilvum (strain PYR-GCK)
B3E6L7 5.8e-21 87 37 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q2IY19 6.18e-21 87 38 1 118 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain HaA2)
A0LQM0 7.61e-21 86 40 4 125 3 hisI Phosphoribosyl-AMP cyclohydrolase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2G9L7 8.5e-21 86 48 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A0LCF4 8.51e-21 86 41 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A4FLL5 8.66e-21 86 38 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q0BWU4 9.26e-21 86 46 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Hyphomonas neptunium (strain ATCC 15444)
A1AT71 1.02e-20 86 38 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A3Q124 1.11e-20 85 38 0 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium sp. (strain JLS)
Q5UZH6 1.22e-20 86 39 3 118 3 hisI Phosphoribosyl-AMP cyclohydrolase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9HN23 1.48e-20 86 38 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7I1 1.48e-20 86 38 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P50935 1.8e-20 85 48 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1B7H1 1.88e-20 85 38 0 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium sp. (strain MCS)
A1UHK1 1.88e-20 85 38 0 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium sp. (strain KMS)
Q47AM4 1.97e-20 85 42 3 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Dechloromonas aromatica (strain RCB)
Q2YAV1 2.24e-20 85 35 3 124 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B9JXX0 2.44e-20 84 48 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
P60544 2.69e-20 86 38 1 118 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O26347 2.75e-20 85 36 1 118 1 hisI Phosphoribosyl-AMP cyclohydrolase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A0QHH5 5.08e-20 84 40 1 105 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium avium (strain 104)
Q2KTT0 5.13e-20 84 42 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Bordetella avium (strain 197N)
Q5NMD7 5.9e-20 84 51 0 84 3 hisE Phosphoribosyl-ATP pyrophosphatase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q1GSW9 6.11e-20 84 42 0 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B3QE24 6.72e-20 85 37 1 118 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain TIE-1)
B5ZV90 8.95e-20 83 47 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A3MSF2 1.25e-19 83 37 1 100 3 hisI Phosphoribosyl-AMP cyclohydrolase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
A4WUS9 1.29e-19 82 48 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
P60542 1.47e-19 83 37 1 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P60543 1.51e-19 83 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A3PI61 1.53e-19 82 48 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A2STB6 2.36e-19 82 44 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q5FPD9 3.16e-19 83 42 2 108 3 hisI Phosphoribosyl-AMP cyclohydrolase Gluconobacter oxydans (strain 621H)
A4YSB5 3.22e-19 82 43 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Bradyrhizobium sp. (strain ORS 278)
Q9X7C3 4.08e-19 82 39 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium leprae (strain TN)
B8ZRB5 4.08e-19 82 39 0 91 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycobacterium leprae (strain Br4923)
Q2KE62 4.4e-19 81 46 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2N8I9 5.96e-19 81 48 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Erythrobacter litoralis (strain HTCC2594)
O28329 6.43e-19 81 42 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7P0E7 6.7e-19 82 39 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q47QS0 6.84e-19 81 40 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Thermobifida fusca (strain YX)
Q89IW3 9.51e-19 81 35 1 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B4RJN2 1.97e-18 80 42 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Neisseria gonorrhoeae (strain NCCP11945)
Q5FA24 1.97e-18 80 42 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2NGK6 2.11e-18 80 32 2 118 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q3ST00 2.19e-18 80 34 2 121 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QMS2 2.28e-18 80 39 0 93 3 hisI Phosphoribosyl-AMP cyclohydrolase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
O33778 2.4e-18 79 46 0 73 3 hisI Phosphoribosyl-AMP cyclohydrolase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q1MNF9 2.59e-18 79 45 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A5ELY1 2.6e-18 80 38 0 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1T8W8 2.71e-18 79 38 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q212N1 3.03e-18 80 43 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain BisB18)
A5UMF9 4.44e-18 79 34 3 121 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q162Q0 4.55e-18 79 49 0 85 3 hisE Phosphoribosyl-ATP pyrophosphatase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P60541 4.76e-18 79 39 1 102 3 hisI Phosphoribosyl-AMP cyclohydrolase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q58825 5.05e-18 79 38 0 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O30723 5.46e-18 78 45 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8FP00 5.67e-18 79 39 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1KSN5 7.29e-18 79 41 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3A2Z2 7.5e-18 79 31 2 129 3 hisI Phosphoribosyl-AMP cyclohydrolase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q28NJ9 7.56e-18 78 46 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Jannaschia sp. (strain CCS1)
Q8ZY39 7.86e-18 79 39 0 84 3 hisI Phosphoribosyl-AMP cyclohydrolase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
A0QX88 9.36e-18 78 37 0 88 3 hisI Phosphoribosyl-AMP cyclohydrolase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q92TB4 9.6e-18 78 47 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium meliloti (strain 1021)
Q9JVH6 1.12e-17 78 40 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B9JG64 1.12e-17 77 45 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C3MBC0 1.13e-17 78 47 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q98CT0 1.14e-17 78 50 2 86 3 hisE Phosphoribosyl-ATP pyrophosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8NNT9 1.33e-17 78 38 2 104 3 hisI Phosphoribosyl-AMP cyclohydrolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6WX51 1.63e-17 77 48 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9KPC7 1.74e-17 77 44 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B3PWH8 1.8e-17 77 44 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhizobium etli (strain CIAT 652)
B8GZS0 2.62e-17 77 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AAY5 2.62e-17 77 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q21FQ0 3.5e-17 77 37 2 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9K0H5 3.7e-17 77 40 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A4QFF8 3.86e-17 77 37 2 104 3 hisI Phosphoribosyl-AMP cyclohydrolase Corynebacterium glutamicum (strain R)
A1B389 4.19e-17 76 47 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Paracoccus denitrificans (strain Pd 1222)
A8A9Z2 4.73e-17 77 35 1 98 3 hisI Phosphoribosyl-AMP cyclohydrolase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
A7HSG7 5.79e-17 76 52 0 82 3 hisE Phosphoribosyl-ATP pyrophosphatase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
P00815 6.42e-17 81 34 5 173 1 HIS4 Histidine biosynthesis trifunctional protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B0T5D0 6.56e-17 76 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Caulobacter sp. (strain K31)
A4FZQ7 7.71e-17 76 38 0 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6VIS0 8.76e-17 76 42 0 76 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q2YQ02 1.4e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella abortus (strain 2308)
P58836 1.56e-16 75 34 2 117 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q11CK6 1.79e-16 75 47 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Chelativorans sp. (strain BNC1)
Q8YH95 2.15e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJ48 2.15e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57D60 2.15e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella abortus biovar 1 (strain 9-941)
B2S5T1 2.15e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella abortus (strain S19)
Q8G0L3 2.42e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella suis biovar 1 (strain 1330)
B0CGM5 2.42e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M587 2.42e-16 75 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6X0X1 2.71e-16 75 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9A817 3.12e-16 74 41 0 77 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
B0SMB9 3.18e-16 73 40 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SDY7 3.18e-16 73 40 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q92QB5 4.21e-16 75 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium meliloti (strain 1021)
Q07P45 4.56e-16 75 41 1 89 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhodopseudomonas palustris (strain BisA53)
Q11JM5 5.63e-16 74 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Chelativorans sp. (strain BNC1)
B3E616 6.15e-16 73 48 0 93 3 hisE Phosphoribosyl-ATP pyrophosphatase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9JFG9 6.68e-16 74 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q12670 6.93e-16 78 33 5 173 3 HIS4 Histidine biosynthesis trifunctional protein Saccharomyces bayanus
P64352 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella suis biovar 1 (strain 1330)
B0CJI7 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT44 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P64351 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFX4 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9S0 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AH2 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella abortus biovar 1 (strain 9-941)
Q2YQY7 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella abortus (strain 2308)
B2S985 7.98e-16 73 45 0 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Brucella abortus (strain S19)
Q2RNA8 9.76e-16 73 50 0 69 3 hisE Phosphoribosyl-ATP pyrophosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C3MB44 1.05e-15 73 41 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6U8C1 1.59e-15 73 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Sinorhizobium medicae (strain WSM419)
B0T797 3.3e-15 71 48 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Caulobacter sp. (strain K31)
Q3J6P9 4.29e-15 71 42 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0VMA1 5.29e-15 71 52 1 75 3 hisE Phosphoribosyl-ATP pyrophosphatase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3IU57 9.17e-15 70 48 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q5LUA0 1.36e-14 70 46 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8UEK7 1.67e-14 70 36 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UJ91 1.85e-14 69 49 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
P62391 1.85e-14 70 38 0 76 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q1MGA3 1.95e-14 70 38 1 97 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q98LQ5 2.15e-14 70 40 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1R002 2.26e-14 69 41 1 93 3 hisE Phosphoribosyl-ATP pyrophosphatase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1H4R0 2.35e-14 69 43 0 85 3 hisE Phosphoribosyl-ATP pyrophosphatase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3SI69 2.6e-14 69 43 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Thiobacillus denitrificans (strain ATCC 25259)
B5ZQK7 3.29e-14 70 37 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
O13471 3.95e-14 73 30 4 173 3 HIS4 Histidine biosynthesis trifunctional protein Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q5FTN2 4.07e-14 69 41 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Gluconobacter oxydans (strain 621H)
A1KAV2 4.17e-14 68 41 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Azoarcus sp. (strain BH72)
B3PNV9 4.32e-14 69 33 2 119 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium etli (strain CIAT 652)
P60536 5.01e-14 68 46 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5P797 5.22e-14 68 42 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
C1DHS6 5.23e-14 68 46 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q43926 5.55e-14 68 46 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Azotobacter chroococcum mcd 1
Q2K853 6.3e-14 69 36 1 90 3 hisI Phosphoribosyl-AMP cyclohydrolase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P07685 6.99e-14 72 32 6 186 3 his-3 Histidine biosynthesis trifunctional protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A2SE11 1.01e-13 68 41 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A6URR6 1.04e-13 68 36 0 76 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q50837 1.04e-13 68 36 0 76 1 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus vannielii
Q1GEZ2 1.38e-13 67 46 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Ruegeria sp. (strain TM1040)
B8DA64 1.42e-13 67 43 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria monocytogenes serotype 4a (strain HCC23)
A6UT21 1.79e-13 67 32 2 108 3 hisI Phosphoribosyl-AMP cyclohydrolase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q2YAV2 1.99e-13 67 39 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B8GW16 2.07e-13 67 44 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A228 2.07e-13 67 44 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q18KL7 2.62e-13 66 45 1 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A8HYT3 2.68e-13 66 49 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q39YP1 2.95e-13 66 44 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5FYE6 3.08e-13 67 45 0 77 3 hisE Phosphoribosyl-ATP pyrophosphatase Acidiphilium cryptum (strain JF-5)
A8A8G1 3.12e-13 66 42 0 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q47AM5 3.7e-13 66 38 0 88 3 hisE Phosphoribosyl-ATP pyrophosphatase Dechloromonas aromatica (strain RCB)
Q89WM3 4.3e-13 65 42 0 87 3 hisE1 Phosphoribosyl-ATP pyrophosphatase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q0BPX5 4.97e-13 67 42 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A4VGE1 5.56e-13 65 45 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Stutzerimonas stutzeri (strain A1501)
A6UEK2 5.98e-13 65 48 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Sinorhizobium medicae (strain WSM419)
Q1BS33 5.99e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia orbicola (strain AU 1054)
A0K3W0 5.99e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia cenocepacia (strain HI2424)
Q92E90 6.15e-13 65 43 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B1JUA7 6.72e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia orbicola (strain MC0-3)
Q39K83 6.72e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E643 6.72e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0BIW2 7.86e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRW3 7.86e-13 65 42 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia ambifaria (strain MC40-6)
Q1I3S6 8.31e-13 65 41 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas entomophila (strain L48)
Q9HMD4 8.89e-13 64 44 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R877 8.89e-13 64 44 1 90 3 hisE Phosphoribosyl-ATP pyrophosphatase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8PUG2 9.01e-13 65 40 1 84 3 hisE Phosphoribosyl-ATP pyrophosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A1U671 9.17e-13 65 43 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8IPH2 1.12e-12 65 47 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A6VDJ0 1.13e-12 65 43 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas aeruginosa (strain PA7)
Q82WM7 1.18e-12 65 34 0 93 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q12UV8 1.64e-12 64 39 1 92 3 hisE Phosphoribosyl-ATP pyrophosphatase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q9HUB6 1.75e-12 64 43 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V3G0 1.75e-12 64 43 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas aeruginosa (strain LESB58)
Q8Y9G7 1.78e-12 64 42 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3SWF2 2.48e-12 64 40 0 77 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1GQI3 2.48e-12 63 42 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B1J2S4 2.8e-12 63 41 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas putida (strain W619)
Q88D14 2.8e-12 63 41 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA49 2.8e-12 63 41 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q2SN16 3.2e-12 63 40 1 92 3 hisE Phosphoribosyl-ATP pyrophosphatase Hahella chejuensis (strain KCTC 2396)
B0KM40 3.21e-12 63 41 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas putida (strain GB-1)
Q845U5 3.33e-12 63 41 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0AET9 3.33e-12 63 32 0 92 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A4XPM3 3.49e-12 63 45 1 91 3 hisE Phosphoribosyl-ATP pyrophosphatase Pseudomonas mendocina (strain ymp)
A4JAX1 3.51e-12 63 41 2 97 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia vietnamiensis (strain G4 / LMG 22486)
O59667 4.2e-12 67 31 5 176 3 his7 Histidine biosynthesis bifunctional protein his7 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P60538 4.53e-12 63 39 0 87 3 hisE1 Phosphoribosyl-ATP pyrophosphatase 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O33776 4.56e-12 62 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q603K5 4.6e-12 63 40 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1QRW9 4.98e-12 63 42 0 71 3 hisE Phosphoribosyl-ATP pyrophosphatase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A6UTD9 5.73e-12 62 49 1 75 3 hisE Phosphoribosyl-ATP pyrophosphatase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
A5CZ71 6.08e-12 62 46 0 71 3 hisE Phosphoribosyl-ATP pyrophosphatase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B1ILB2 6.46e-12 63 37 0 83 3 hisE Phosphoribosyl-ATP pyrophosphatase Clostridium botulinum (strain Okra / Type B1)
B9IV02 6.81e-12 62 36 1 94 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus cereus (strain Q1)
P58834 7.11e-12 62 40 1 84 3 hisE Phosphoribosyl-ATP pyrophosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B7JFZ7 7.89e-12 62 37 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus cereus (strain AH820)
P60534 7.89e-12 62 37 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus anthracis
C3L9P5 7.89e-12 62 37 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P507 7.89e-12 62 37 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus anthracis (strain A0248)
Q31E63 1.05e-11 62 35 1 95 3 hisE Phosphoribosyl-ATP pyrophosphatase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q722Y9 1.11e-11 62 40 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria monocytogenes serotype 4b (strain F2365)
C1L0J0 1.11e-11 62 40 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria monocytogenes serotype 4b (strain CLIP80459)
B7HKD6 1.15e-11 62 34 1 94 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus cereus (strain AH187)
Q5UZW6 1.35e-11 62 43 1 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q63Q94 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia pseudomallei (strain K96243)
A3NE91 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia pseudomallei (strain 668)
Q3JN04 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia pseudomallei (strain 1710b)
A3P025 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia pseudomallei (strain 1106a)
A1V8H7 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia mallei (strain SAVP1)
Q62GE7 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia mallei (strain ATCC 23344)
A2S756 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia mallei (strain NCTC 10229)
A3MPU2 1.37e-11 62 42 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia mallei (strain NCTC 10247)
C3NER1 1.59e-11 61 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3NGY3 1.59e-11 61 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MW61 1.59e-11 61 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MQI3 1.59e-11 61 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KHR8 1.59e-11 61 47 0 68 3 hisE Phosphoribosyl-ATP pyrophosphatase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
A9A8P0 1.87e-11 61 37 1 95 3 hisE Phosphoribosyl-ATP pyrophosphatase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A0PXP9 2.1e-11 61 35 0 87 3 hisE Phosphoribosyl-ATP pyrophosphatase Clostridium novyi (strain NT)
A9VLH9 2.29e-11 61 34 0 81 3 hisE Phosphoribosyl-ATP pyrophosphatase Bacillus mycoides (strain KBAB4)
C1FN44 2.54e-11 61 36 0 83 3 hisE Phosphoribosyl-ATP pyrophosphatase Clostridium botulinum (strain Kyoto / Type A2)
Q2SUB0 2.8e-11 61 41 2 96 3 hisE Phosphoribosyl-ATP pyrophosphatase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0AG13 3.06e-11 60 40 1 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A3CNS8 3.24e-11 60 44 0 77 3 hisE Phosphoribosyl-ATP pyrophosphatase Streptococcus sanguinis (strain SK36)
Q97KH6 3.43e-11 61 35 0 89 3 hisE Phosphoribosyl-ATP pyrophosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_09905
Feature type CDS
Gene hisIE
Product bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Location 140877 - 141488 (strand: 1)
Length 612 (nucleotides) / 203 (amino acids)
In genomic island -

Contig

Accession ZDB_366
Length 191897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1251
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01502 Phosphoribosyl-AMP cyclohydrolase
PF01503 Phosphoribosyl-ATP pyrophosphohydrolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0139 Amino acid transport and metabolism (E) E Phosphoribosyl-AMP cyclohydrolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11755 phosphoribosyl-AMP cyclohydrolase / phosphoribosyl-ATP pyrophosphohydrolase [EC:3.5.4.19 3.6.1.31] Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Histidine biosynthesis, PRPP => histidine

Protein Sequence

MLTEQEIAQLDWQKTGDLLPVIVQHAVSGDVLMLGYMNRDALDKTISEKRVTFYSRTKQRLWTKGESSGHFLNLEDLFKDCDNDTLLALVTPIGPTCHQGTNSCFAPAQTAQGFLYELESVIKSRKTADPDSSYTAQLYAAGTKRIAQKVGEEGVETALAATVRDKAELTSESADLLYHLLVLLQDADLDLAAVIEKLRSRHR

Flanking regions ( +/- flanking 50bp)

GCGGACTTGCCCGCGACGGGATCGTTGTCAGAATACAGGAGTAACACACGATGCTCACGGAACAGGAAATCGCACAACTGGACTGGCAGAAAACCGGCGATCTGCTGCCGGTTATTGTGCAGCACGCCGTCTCCGGTGATGTGCTGATGCTGGGCTACATGAACCGCGACGCACTGGACAAAACGATCAGCGAAAAACGCGTGACGTTTTATTCCCGCACCAAACAGCGGTTGTGGACCAAAGGGGAATCGTCCGGGCATTTCCTTAATCTGGAAGACCTGTTTAAAGATTGTGATAACGACACGCTGCTCGCGCTGGTCACCCCGATCGGCCCGACCTGTCATCAGGGTACCAACAGCTGTTTTGCGCCCGCACAGACAGCCCAGGGTTTCCTGTATGAACTGGAGTCTGTTATAAAATCCCGCAAAACGGCGGATCCGGACAGCTCTTACACAGCACAACTCTATGCCGCCGGGACCAAACGGATTGCCCAGAAAGTGGGCGAGGAAGGCGTGGAAACCGCACTGGCCGCCACTGTCCGCGATAAGGCGGAACTGACCTCAGAATCCGCGGATCTGCTCTATCACCTGCTGGTACTGCTCCAGGATGCCGATCTGGATCTGGCCGCTGTTATTGAAAAACTGCGTTCCCGTCACCGTTAATCCGAAAGCGGGGGAAATCCTTTTTTGTCCGCTGTTTTTGTTGCCGTAAC