Homologs in group_1060

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06000 FBDBKF_06000 100.0 Morganella morganii S1 pyrH UMP kinase
EHELCC_09045 EHELCC_09045 100.0 Morganella morganii S2 pyrH UMP kinase
NLDBIP_09425 NLDBIP_09425 100.0 Morganella morganii S4 pyrH UMP kinase
HKOGLL_07880 HKOGLL_07880 100.0 Morganella morganii S5 pyrH UMP kinase
F4V73_RS15895 F4V73_RS15895 98.8 Morganella psychrotolerans pyrH UMP kinase
PMI_RS11275 PMI_RS11275 95.5 Proteus mirabilis HI4320 pyrH UMP kinase

Distribution of the homologs in the orthogroup group_1060

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1060

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JP80 2.12e-169 469 93 0 242 3 pyrH Uridylate kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q667J1 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TL89 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pestis (strain Pestoides F)
Q1CFE9 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH64 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pestis
Q1CAN2 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFH1 4.13e-168 466 93 0 241 3 pyrH Uridylate kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GIE4 9e-167 462 93 0 241 3 pyrH Uridylate kinase Serratia proteamaculans (strain 568)
Q6D8E1 1.98e-166 462 92 0 241 3 pyrH Uridylate kinase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MGT0 2.8e-162 451 91 0 240 3 pyrH Uridylate kinase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NRK9 5.77e-162 450 89 0 241 3 pyrH Uridylate kinase Sodalis glossinidius (strain morsitans)
A6T4X3 1.37e-161 449 90 0 240 3 pyrH Uridylate kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3Z5I7 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Shigella sonnei (strain Ss046)
P0A7F2 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Shigella flexneri
Q0T838 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Shigella flexneri serotype 5b (strain 8401)
Q325W9 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Shigella boydii serotype 4 (strain Sb227)
Q1RG18 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli (strain UTI89 / UPEC)
P0A7E9 1.93e-161 449 90 0 240 1 pyrH Uridylate kinase Escherichia coli (strain K12)
P0A7F0 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLG2 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7L5 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O1:K1 / APEC
A7ZWB7 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O9:H4 (strain HS)
P0A7F1 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O157:H7
A7ZHR1 1.93e-161 449 90 0 240 3 pyrH Uridylate kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
A4W6R6 3.12e-161 448 90 0 240 3 pyrH Uridylate kinase Enterobacter sp. (strain 638)
A8ALB8 3.64e-161 448 90 0 240 3 pyrH Uridylate kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32JT8 3.8e-161 448 90 0 240 3 pyrH Uridylate kinase Shigella dysenteriae serotype 1 (strain Sd197)
P65933 6.44e-161 447 90 0 240 1 pyrH Uridylate kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65934 6.44e-161 447 90 0 240 3 pyrH Uridylate kinase Salmonella typhi
Q5PD61 6.44e-161 447 90 0 240 3 pyrH Uridylate kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57T37 6.44e-161 447 90 0 240 3 pyrH Uridylate kinase Salmonella choleraesuis (strain SC-B67)
Q6LN26 3.52e-157 438 87 0 240 3 pyrH Uridylate kinase Photobacterium profundum (strain SS9)
Q7N8P5 7.15e-155 432 94 0 239 3 pyrH Uridylate kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4SQI0 1.89e-152 426 86 0 239 3 pyrH Uridylate kinase Aeromonas salmonicida (strain A449)
A0KHG5 1.41e-150 422 85 0 239 3 pyrH Uridylate kinase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1S4P2 6.61e-150 420 83 0 241 3 pyrH Uridylate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12NY5 2.43e-149 419 85 0 240 3 pyrH Uridylate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1RLM5 1.04e-148 417 83 0 239 3 pyrH Uridylate kinase Shewanella sp. (strain W3-18-1)
A4Y545 1.1e-148 417 83 0 239 3 pyrH Uridylate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q5QXS2 1.16e-148 417 83 0 242 3 pyrH Uridylate kinase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q085E0 1.2e-148 417 83 0 240 3 pyrH Uridylate kinase Shewanella frigidimarina (strain NCIMB 400)
Q9KPV4 1.46e-148 417 88 0 240 3 pyrH Uridylate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F619 1.46e-148 417 88 0 240 3 pyrH Uridylate kinase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A6WLA8 5.03e-148 415 83 0 239 3 pyrH Uridylate kinase Shewanella baltica (strain OS185)
A3D2K7 5.03e-148 415 83 0 239 3 pyrH Uridylate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A0KZ21 1.04e-147 414 83 0 240 3 pyrH Uridylate kinase Shewanella sp. (strain ANA-3)
Q5E3E1 1.88e-147 414 87 0 240 3 pyrH Uridylate kinase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0HT64 2.17e-147 414 83 0 239 3 pyrH Uridylate kinase Shewanella sp. (strain MR-7)
Q0HGV7 2.17e-147 414 83 0 239 3 pyrH Uridylate kinase Shewanella sp. (strain MR-4)
A3QGA1 2.51e-147 414 83 0 239 3 pyrH Uridylate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EGH3 3.01e-147 413 82 0 240 3 pyrH Uridylate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7MIG2 5.37e-147 412 87 0 240 3 pyrH Uridylate kinase Vibrio vulnificus (strain YJ016)
Q8DBF9 5.37e-147 412 87 0 240 3 pyrH Uridylate kinase Vibrio vulnificus (strain CMCP6)
Q485G8 1.86e-146 411 82 0 240 3 pyrH Uridylate kinase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q15WG1 2.13e-145 409 82 0 241 3 pyrH Uridylate kinase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7N1X5 4.06e-145 408 85 0 242 3 pyrH Uridylate kinase Vibrio campbellii (strain ATCC BAA-1116)
Q3IIX6 1.92e-144 406 79 0 240 3 pyrH Uridylate kinase Pseudoalteromonas translucida (strain TAC 125)
Q87ME0 1.97e-144 406 85 0 242 3 pyrH Uridylate kinase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1SYW1 9.78e-141 397 79 0 241 3 pyrH Uridylate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q493D0 4.19e-136 385 73 0 241 3 pyrH Uridylate kinase Blochmanniella pennsylvanica (strain BPEN)
P43890 5.38e-134 379 76 0 236 1 pyrH Uridylate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CJL5 1.94e-133 378 80 0 236 3 pyrH Uridylate kinase Pasteurella multocida (strain Pm70)
Q65R73 9.48e-132 374 79 0 235 3 pyrH Uridylate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VM31 9.86e-129 366 78 0 236 3 pyrH Uridylate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A3MZT5 2.32e-128 365 77 0 236 3 pyrH Uridylate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VL82 1.2e-127 363 78 0 236 3 pyrH Uridylate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0I378 1.65e-127 363 77 0 236 3 pyrH Uridylate kinase Histophilus somni (strain 129Pt)
Q4QLM2 7.05e-125 356 76 0 236 3 pyrH Uridylate kinase Haemophilus influenzae (strain 86-028NP)
A5UIJ1 3.13e-124 355 76 0 236 3 pyrH Uridylate kinase Haemophilus influenzae (strain PittGG)
A5UD40 5.47e-124 354 76 0 236 3 pyrH Uridylate kinase Haemophilus influenzae (strain PittEE)
Q7VRE4 5.47e-123 352 65 1 243 3 pyrH Uridylate kinase Blochmanniella floridana
A1U3Q2 1.26e-113 328 67 1 241 3 pyrH Uridylate kinase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4XWT9 2.27e-113 328 68 0 237 3 pyrH Uridylate kinase Pseudomonas mendocina (strain ymp)
A6V1D4 1.96e-112 325 69 0 234 3 pyrH Uridylate kinase Pseudomonas aeruginosa (strain PA7)
P57327 3.51e-112 324 61 1 242 3 pyrH Uridylate kinase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O82852 4.64e-112 324 69 0 234 3 pyrH Uridylate kinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RC6 4.64e-112 324 69 0 234 3 pyrH Uridylate kinase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1I628 7.62e-112 324 69 0 234 3 pyrH Uridylate kinase Pseudomonas entomophila (strain L48)
Q1R031 9.9e-112 324 67 0 238 3 pyrH Uridylate kinase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q88MH8 1.04e-111 323 69 0 234 3 pyrH Uridylate kinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W848 1.04e-111 323 69 0 234 3 pyrH Uridylate kinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q21HH4 1.18e-111 323 67 0 232 3 pyrH Uridylate kinase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4VJS3 5.23e-111 322 68 0 233 3 pyrH Uridylate kinase Stutzerimonas stutzeri (strain A1501)
Q2SBP9 1.51e-110 320 65 0 240 3 pyrH Uridylate kinase Hahella chejuensis (strain KCTC 2396)
P59002 2.85e-110 320 60 0 239 3 pyrH Uridylate kinase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4ZWS6 1.67e-108 315 68 0 231 3 pyrH Uridylate kinase Pseudomonas syringae pv. syringae (strain B728a)
Q4KHH4 1.93e-108 315 68 0 231 3 pyrH Uridylate kinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q886P1 2.4e-108 315 68 0 231 3 pyrH Uridylate kinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48F61 2.4e-108 315 68 0 231 3 pyrH Uridylate kinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1LSV5 3.34e-108 315 67 0 234 3 pyrH Uridylate kinase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3KHB0 1.21e-107 313 67 0 231 3 pyrH Uridylate kinase Pseudomonas fluorescens (strain Pf0-1)
Q83BV3 3.74e-104 304 59 0 241 3 pyrH Uridylate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q5WVY9 1.03e-101 298 60 0 237 3 pyrH Uridylate kinase Legionella pneumophila (strain Lens)
Q5X4J9 2.41e-101 297 60 0 237 3 pyrH Uridylate kinase Legionella pneumophila (strain Paris)
Q0VQF5 1.25e-100 295 65 1 241 3 pyrH Uridylate kinase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5ZUT0 2.15e-100 295 60 0 237 3 pyrH Uridylate kinase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5ICK8 2.22e-100 295 60 0 237 3 pyrH Uridylate kinase Legionella pneumophila (strain Corby)
Q3JCX3 5.9e-98 288 59 0 237 3 pyrH Uridylate kinase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0A7I2 3.19e-96 284 58 0 237 3 pyrH Uridylate kinase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1BHI0 2.95e-95 281 58 0 231 3 pyrH Uridylate kinase Burkholderia orbicola (strain AU 1054)
A0K8E1 2.95e-95 281 58 0 231 3 pyrH Uridylate kinase Burkholderia cenocepacia (strain HI2424)
Q39F45 3.84e-95 281 58 0 231 3 pyrH Uridylate kinase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1WHU4 7.26e-95 280 57 0 237 3 pyrH Uridylate kinase Verminephrobacter eiseniae (strain EF01-2)
Q5H1E3 9.33e-95 280 59 0 232 3 pyrH Uridylate kinase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4A8 9.33e-95 280 59 0 232 3 pyrH Uridylate kinase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1W916 2.26e-94 279 57 0 237 3 pyrH Uridylate kinase Acidovorax sp. (strain JS42)
A2SH96 2.65e-94 279 57 0 233 3 pyrH Uridylate kinase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q2SWZ6 3.16e-94 279 57 0 231 3 pyrH Uridylate kinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0KA18 3.41e-94 279 56 0 233 3 pyrH Uridylate kinase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q63T14 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia pseudomallei (strain K96243)
A3NAU6 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia pseudomallei (strain 668)
Q3JR30 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia pseudomallei (strain 1710b)
A3NWM9 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia pseudomallei (strain 1106a)
A1V567 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia mallei (strain SAVP1)
Q62JC6 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia mallei (strain ATCC 23344)
A2SB74 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia mallei (strain NCTC 10229)
A3MKU1 3.94e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia mallei (strain NCTC 10247)
A6SZP9 4.07e-94 278 54 0 233 3 pyrH Uridylate kinase Janthinobacterium sp. (strain Marseille)
A4JF73 5.41e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q3BVK6 6.05e-94 278 59 0 232 3 pyrH Uridylate kinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0BE17 6.1e-94 278 57 0 231 3 pyrH Uridylate kinase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
P59578 8.5e-94 278 56 0 239 3 pyrH Uridylate kinase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A4G4S3 1.07e-93 278 54 0 233 3 pyrH Uridylate kinase Herminiimonas arsenicoxydans
P59008 1.13e-93 278 59 0 232 3 pyrH Uridylate kinase Xanthomonas axonopodis pv. citri (strain 306)
Q21WY7 1.43e-93 277 57 0 235 3 pyrH Uridylate kinase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1LNF6 1.78e-93 277 55 0 233 3 pyrH Uridylate kinase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q470D9 1.96e-93 277 56 0 233 3 pyrH Uridylate kinase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XZI9 2.1e-93 276 55 0 233 3 pyrH Uridylate kinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P59009 2.1e-93 277 58 0 232 1 pyrH Uridylate kinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4USQ8 2.1e-93 277 58 0 232 3 pyrH Uridylate kinase Xanthomonas campestris pv. campestris (strain 8004)
A1VN42 2.66e-93 276 57 0 233 3 pyrH Uridylate kinase Polaromonas naphthalenivorans (strain CJ2)
A1TN71 3.96e-93 276 57 0 235 3 pyrH Uridylate kinase Paracidovorax citrulli (strain AAC00-1)
Q60BA8 9.18e-93 275 56 0 234 3 pyrH Uridylate kinase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A3M658 9.83e-93 275 61 1 242 3 pyrH Uridylate kinase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q13XB8 1.08e-92 275 57 0 231 3 pyrH Uridylate kinase Paraburkholderia xenovorans (strain LB400)
Q6FCH3 3.61e-92 274 61 1 242 3 pyrH Uridylate kinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9PEH0 6.6e-92 273 55 0 236 3 pyrH Uridylate kinase Xylella fastidiosa (strain 9a5c)
Q3A397 1.23e-91 272 56 0 237 3 pyrH Uridylate kinase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5WGF1 1.34e-91 272 60 1 238 3 pyrH Uridylate kinase Psychrobacter sp. (strain PRwf-1)
Q87EH1 8.51e-91 270 55 0 236 3 pyrH Uridylate kinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q12A33 1.43e-90 270 56 0 233 3 pyrH Uridylate kinase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1WX19 1.85e-90 270 56 0 233 3 pyrH Uridylate kinase Halorhodospira halophila (strain DSM 244 / SL1)
Q1QA12 4.46e-90 268 60 1 238 3 pyrH Uridylate kinase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1H141 4.86e-90 268 54 0 235 3 pyrH Uridylate kinase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q4FRH5 5.2e-90 268 60 1 238 3 pyrH Uridylate kinase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7VYC8 7.05e-90 268 54 0 231 3 pyrH Uridylate kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2YBA5 8.03e-90 268 54 0 233 3 pyrH Uridylate kinase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q47F90 1.82e-89 267 54 0 233 3 pyrH Uridylate kinase Dechloromonas aromatica (strain RCB)
Q7WJ92 2.37e-89 266 54 0 231 3 pyrH Uridylate kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5EV27 5.94e-89 266 54 0 239 3 pyrH Uridylate kinase Dichelobacter nodosus (strain VCS1703A)
Q7WA58 8.51e-89 265 54 0 231 3 pyrH Uridylate kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2L160 2.3e-88 264 53 0 231 3 pyrH Uridylate kinase Bordetella avium (strain 197N)
A0LXJ4 9.81e-88 262 55 0 232 3 pyrH Uridylate kinase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q6AP39 1.85e-87 262 56 0 232 3 pyrH Uridylate kinase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q98MB7 8.36e-87 260 52 0 237 3 pyrH Uridylate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1BHZ3 1.72e-86 259 54 0 231 3 pyrH Uridylate kinase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A0LJ65 5.98e-86 258 49 0 237 3 pyrH Uridylate kinase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2RU07 1.08e-85 258 57 0 222 3 pyrH Uridylate kinase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2IMM2 4e-85 256 52 0 240 3 pyrH Uridylate kinase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q74BW2 4.4e-85 256 54 0 233 3 pyrH Uridylate kinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q0AEH6 5.24e-85 255 53 0 232 3 pyrH Uridylate kinase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q11XK2 7.84e-85 255 51 0 232 3 pyrH Uridylate kinase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8R6G5 1.02e-84 254 52 0 236 3 pyrH Uridylate kinase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A7H724 1.18e-84 255 53 0 240 3 pyrH Uridylate kinase Anaeromyxobacter sp. (strain Fw109-5)
Q39W86 2.5e-84 254 54 0 233 3 pyrH Uridylate kinase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2GHJ6 4.31e-84 253 50 1 239 3 pyrH Uridylate kinase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q3B5T8 1.42e-83 252 52 0 231 3 pyrH Uridylate kinase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A6X0J3 1.86e-83 251 53 0 237 3 pyrH Uridylate kinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1K6R9 2.03e-83 251 57 0 231 3 pyrH Uridylate kinase Azoarcus sp. (strain BH72)
Q0BTM0 2.03e-83 252 52 0 234 3 pyrH Uridylate kinase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P59003 2.12e-83 251 52 0 231 3 pyrH Uridylate kinase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6G5C7 4.97e-83 250 51 0 232 3 pyrH Uridylate kinase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5NZH3 5.92e-83 250 57 0 231 3 pyrH Uridylate kinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A6GWS3 6.25e-83 250 51 0 232 3 pyrH Uridylate kinase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q7NVZ2 7.05e-83 250 56 0 233 3 pyrH Uridylate kinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q57CX9 8.58e-83 250 53 0 235 3 pyrH Uridylate kinase Brucella abortus biovar 1 (strain 9-941)
A7HY17 8.68e-83 250 52 0 235 3 pyrH Uridylate kinase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q82TZ7 1.8e-82 249 51 0 232 3 pyrH Uridylate kinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A5G1L2 2.15e-82 249 53 0 231 3 pyrH Uridylate kinase Acidiphilium cryptum (strain JF-5)
Q3YR64 3.79e-82 248 49 2 242 3 pyrH Uridylate kinase Ehrlichia canis (strain Jake)
Q3AQ27 4.04e-82 248 51 0 234 3 pyrH Uridylate kinase Chlorobium chlorochromatii (strain CaD3)
Q8G0D7 6.75e-82 248 53 0 235 3 pyrH Uridylate kinase Brucella suis biovar 1 (strain 1330)
Q9A705 8.49e-82 248 51 0 240 3 pyrH Uridylate kinase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8YHH4 1.18e-81 247 53 0 235 3 pyrH Uridylate kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YXK5 1.6e-81 247 50 1 239 3 pyrH Uridylate kinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MFI4 1.62e-81 247 50 1 239 3 pyrH Uridylate kinase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q2W4C5 1.78e-81 246 50 1 242 3 pyrH Uridylate kinase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q6FZN2 7.21e-81 245 50 0 232 3 pyrH Uridylate kinase Bartonella quintana (strain Toulouse)
Q0APW3 1.02e-80 245 51 0 235 3 pyrH Uridylate kinase Maricaulis maris (strain MCS10)
Q1D1I1 1.02e-80 245 53 2 236 3 pyrH Uridylate kinase Myxococcus xanthus (strain DK1622)
A7ZEY4 1.09e-80 244 53 2 232 3 pyrH Uridylate kinase Campylobacter concisus (strain 13826)
A3CPA3 1.36e-80 244 50 1 238 3 pyrH Uridylate kinase Streptococcus sanguinis (strain SK36)
A1AQN4 1.53e-80 244 51 0 235 3 pyrH Uridylate kinase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P74457 3.68e-80 244 49 0 234 3 pyrH Uridylate kinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q10Y48 3.74e-80 243 49 0 234 3 pyrH Uridylate kinase Trichodesmium erythraeum (strain IMS101)
A4VW04 5.85e-80 243 51 1 236 3 pyrH Uridylate kinase Streptococcus suis (strain 05ZYH33)
A4W2B2 5.85e-80 243 51 1 236 3 pyrH Uridylate kinase Streptococcus suis (strain 98HAH33)
A5GSA3 6.82e-80 242 52 0 232 3 pyrH Uridylate kinase Synechococcus sp. (strain RCC307)
Q8RT65 7.69e-80 242 49 0 232 3 pyrH Uridylate kinase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q97R83 8.95e-80 243 50 1 239 1 pyrH Uridylate kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q3AB79 1.16e-79 242 50 1 234 3 pyrH Uridylate kinase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3AV98 1.5e-79 241 51 0 231 3 pyrH Uridylate kinase Synechococcus sp. (strain CC9902)
Q5L0K0 2.91e-79 241 50 1 235 3 pyrH Uridylate kinase Geobacillus kaustophilus (strain HTA426)
Q5HAF8 3.14e-79 241 50 1 225 3 pyrH Uridylate kinase Ehrlichia ruminantium (strain Welgevonden)
Q5FG65 3.14e-79 241 50 1 225 3 pyrH Uridylate kinase Ehrlichia ruminantium (strain Gardel)
Q0I8L5 3.32e-79 241 51 0 232 3 pyrH Uridylate kinase Synechococcus sp. (strain CC9311)
Q1IV36 3.54e-79 241 54 1 237 3 pyrH Uridylate kinase Koribacter versatilis (strain Ellin345)
Q7VD61 3.95e-79 240 48 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A4IMC5 4.26e-79 240 49 1 235 3 pyrH Uridylate kinase Geobacillus thermodenitrificans (strain NG80-2)
A8AY71 5.24e-79 240 50 1 238 3 pyrH Uridylate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q313G6 5.42e-79 240 51 1 231 3 pyrH Uridylate kinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q24UF9 7.6e-79 240 49 0 236 3 pyrH Uridylate kinase Desulfitobacterium hafniense (strain Y51)
Q3ALP7 9.25e-79 239 51 0 231 3 pyrH Uridylate kinase Synechococcus sp. (strain CC9605)
Q057S9 1.16e-78 239 48 1 232 3 pyrH Uridylate kinase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q3SKN7 1.3e-78 239 56 1 234 3 pyrH Uridylate kinase Thiobacillus denitrificans (strain ATCC 25259)
Q2JS42 1.64e-78 239 51 1 234 3 pyrH Uridylate kinase Synechococcus sp. (strain JA-3-3Ab)
Q04KY1 1.86e-78 239 50 1 239 3 pyrH Uridylate kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8DQ50 1.88e-78 239 50 1 239 3 pyrH Uridylate kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q7U5F5 1.99e-78 239 51 0 231 3 pyrH Uridylate kinase Parasynechococcus marenigrum (strain WH8102)
Q74IR8 3.1e-78 238 49 1 235 3 pyrH Uridylate kinase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q044C8 3.17e-78 238 49 1 235 3 pyrH Uridylate kinase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5N3B6 3.21e-78 238 51 0 231 3 pyrH Uridylate kinase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QY1 3.21e-78 238 51 0 231 3 pyrH Uridylate kinase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8RA23 3.54e-78 238 51 1 233 3 pyrH Uridylate kinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6MGY5 3.74e-78 238 49 0 234 3 pyrH Uridylate kinase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8F142 3.98e-78 238 49 1 240 3 pyrH Uridylate kinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U12 3.98e-78 238 49 1 240 3 pyrH Uridylate kinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A1VFB1 4.26e-78 238 51 1 232 3 pyrH Uridylate kinase Nitratidesulfovibrio vulgaris (strain DP4)
Q72DQ8 4.26e-78 238 51 1 232 3 pyrH Uridylate kinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A8GV49 4.55e-78 238 48 1 239 3 pyrH Uridylate kinase Rickettsia bellii (strain OSU 85-389)
Q5GRI0 5.83e-78 238 47 1 236 3 pyrH Uridylate kinase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q8XJQ8 7.27e-78 237 51 1 233 3 pyrH Uridylate kinase Clostridium perfringens (strain 13 / Type A)
Q0TPQ5 7.27e-78 237 51 1 233 3 pyrH Uridylate kinase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A0Q0R8 8.02e-78 237 49 1 233 3 pyrH Uridylate kinase Clostridium novyi (strain NT)
Q2JJE2 1.06e-77 237 51 1 234 3 pyrH Uridylate kinase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q97I64 1.07e-77 237 49 1 233 3 pyrH Uridylate kinase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1RHF2 1.08e-77 237 48 1 239 3 pyrH Uridylate kinase Rickettsia bellii (strain RML369-C)
Q053N3 1.52e-77 237 48 0 232 3 pyrH Uridylate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U70 1.52e-77 237 48 0 232 3 pyrH Uridylate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2S6J2 1.84e-77 237 50 0 234 3 pyrH Uridylate kinase Salinibacter ruber (strain DSM 13855 / M31)
Q0SSC2 2.16e-77 236 50 1 233 3 pyrH Uridylate kinase Clostridium perfringens (strain SM101 / Type A)
Q31G45 2.21e-77 236 52 0 231 3 pyrH Uridylate kinase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O66929 2.46e-77 236 50 1 235 3 pyrH Uridylate kinase Aquifex aeolicus (strain VF5)
Q5F5F5 4.69e-77 235 51 0 231 3 pyrH Uridylate kinase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A4J5Z1 4.95e-77 235 46 0 236 3 pyrH Uridylate kinase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q73HM2 5.1e-77 235 47 2 242 3 pyrH Uridylate kinase Wolbachia pipientis wMel
Q7V6C2 9.75e-77 234 49 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9313)
Q5FPZ5 1.21e-76 234 50 0 234 3 pyrH Uridylate kinase Gluconobacter oxydans (strain 621H)
A8GMC4 1.64e-76 234 47 0 231 3 pyrH Uridylate kinase Rickettsia akari (strain Hartford)
Q038L4 1.7e-76 234 51 1 232 3 pyrH Uridylate kinase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5FJM5 1.89e-76 234 48 1 235 3 pyrH Uridylate kinase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P65932 1.92e-76 234 51 0 231 1 pyrH Uridylate kinase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65931 1.92e-76 234 51 0 231 3 pyrH Uridylate kinase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A2C7Q3 2.05e-76 234 49 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9303)
A7GXE5 2.31e-76 233 52 1 222 3 pyrH Uridylate kinase Campylobacter curvus (strain 525.92)
Q7NI44 3e-76 233 49 1 232 3 pyrH Uridylate kinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9ZE07 3.8e-76 233 47 0 231 3 pyrH Uridylate kinase Rickettsia prowazekii (strain Madrid E)
Q03M16 4.01e-76 233 48 1 237 3 pyrH Uridylate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M141 4.01e-76 233 48 1 237 3 pyrH Uridylate kinase Streptococcus thermophilus (strain CNRZ 1066)
Q46GQ4 4.11e-76 233 49 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain NATL2A)
A2C0Y1 4.11e-76 233 49 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain NATL1A)
A5GJF0 4.16e-76 233 50 0 232 3 pyrH Uridylate kinase Synechococcus sp. (strain WH7803)
A5V3G4 4.25e-76 233 49 1 235 3 pyrH Uridylate kinase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A1KWH8 4.34e-76 233 51 0 231 3 pyrH Uridylate kinase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q049U4 4.48e-76 233 50 1 235 3 pyrH Uridylate kinase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9N8 4.48e-76 233 50 1 235 3 pyrH Uridylate kinase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q0AYK2 4.74e-76 233 51 0 236 3 pyrH Uridylate kinase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q92Q53 4.84e-76 233 48 0 237 3 pyrH Uridylate kinase Rhizobium meliloti (strain 1021)
Q8DYG8 5.1e-76 233 48 1 236 3 pyrH Uridylate kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K010 5.1e-76 233 48 1 236 3 pyrH Uridylate kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q831V1 5.76e-76 233 49 1 235 1 pyrH Uridylate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
Q8E431 6.01e-76 233 48 1 236 3 pyrH Uridylate kinase Streptococcus agalactiae serotype III (strain NEM316)
Q8UFM1 6.56e-76 233 49 0 236 3 pyrH Uridylate kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4UKF4 7.15e-76 232 47 0 231 3 pyrH Uridylate kinase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68XL3 7.38e-76 232 46 0 231 3 pyrH Uridylate kinase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92J71 7.55e-76 232 47 0 231 3 pyrH Uridylate kinase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A6LHB0 7.83e-76 232 54 0 231 3 pyrH Uridylate kinase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q64YI2 8.26e-76 232 53 0 231 3 pyrH Uridylate kinase Bacteroides fragilis (strain YCH46)
Q5LHK5 8.26e-76 232 53 0 231 3 pyrH Uridylate kinase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q2G8K8 9.28e-76 232 50 0 236 3 pyrH Uridylate kinase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q8DM63 1.08e-75 232 48 0 234 3 pyrH Uridylate kinase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A1AVT7 1.33e-75 231 48 3 235 3 pyrH Uridylate kinase Ruthia magnifica subsp. Calyptogena magnifica
Q5M5N0 2.17e-75 231 48 1 237 3 pyrH Uridylate kinase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q6N5Q3 2.48e-75 231 49 0 236 3 pyrH Uridylate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q895L0 2.96e-75 231 47 1 234 3 pyrH Uridylate kinase Clostridium tetani (strain Massachusetts / E88)
Q1GRQ2 3.29e-75 231 51 0 235 3 pyrH Uridylate kinase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A0AIB4 3.51e-75 231 48 2 235 3 pyrH Uridylate kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P65927 3.51e-75 231 48 2 235 3 pyrH Uridylate kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720A9 3.51e-75 231 48 2 235 3 pyrH Uridylate kinase Listeria monocytogenes serotype 4b (strain F2365)
P65928 3.51e-75 231 48 2 235 3 pyrH Uridylate kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A6L1I4 3.68e-75 230 54 0 231 3 pyrH Uridylate kinase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A0L8Q7 4.09e-75 230 50 0 230 3 pyrH Uridylate kinase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q02AL3 6.21e-75 230 53 0 231 3 pyrH Uridylate kinase Solibacter usitatus (strain Ellin6076)
P0DD73 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UX7 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RG31 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J833 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JN32 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD59 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65940 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDH4 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD72 7.78e-75 230 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65938 7.78e-75 230 49 1 236 1 pyrH Uridylate kinase Streptococcus pyogenes serotype M1
Q8A5J7 7.89e-75 229 52 0 231 3 pyrH Uridylate kinase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A4YVG4 8.61e-75 229 48 0 236 3 pyrH Uridylate kinase Bradyrhizobium sp. (strain ORS 278)
Q8DSY1 8.95e-75 229 47 1 236 3 pyrH Uridylate kinase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A8F0R3 1.17e-74 229 46 0 231 3 pyrH Uridylate kinase Rickettsia massiliae (strain Mtu5)
Q7V2F8 1.21e-74 229 47 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q1JI78 1.27e-74 229 49 1 236 3 pyrH Uridylate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
A5I4L0 1.27e-74 229 48 1 235 3 pyrH Uridylate kinase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPZ6 1.27e-74 229 48 1 235 3 pyrH Uridylate kinase Clostridium botulinum (strain ATCC 19397 / Type A)
Q166F6 1.39e-74 229 47 1 240 3 pyrH Uridylate kinase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q07NJ1 1.45e-74 229 48 0 236 3 pyrH Uridylate kinase Rhodopseudomonas palustris (strain BisA53)
A3PBP6 1.69e-74 229 47 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9301)
A2BVI4 2.02e-74 228 47 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9515)
Q49X43 2.17e-74 228 45 2 242 3 pyrH Uridylate kinase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2K8Y5 2.73e-74 228 49 0 235 3 pyrH Uridylate kinase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A5EK53 2.82e-74 228 47 0 236 3 pyrH Uridylate kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8G3N7 2.99e-74 228 47 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9215)
A2BQ03 3.02e-74 228 47 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain AS9601)
A6U8K4 3.55e-74 228 48 0 237 3 pyrH Uridylate kinase Sinorhizobium medicae (strain WSM419)
Q31C12 3.64e-74 228 48 0 232 3 pyrH Uridylate kinase Prochlorococcus marinus (strain MIT 9312)
Q5PBQ6 3.73e-74 228 47 1 232 3 pyrH Uridylate kinase Anaplasma marginale (strain St. Maries)
Q1QMN5 4.51e-74 228 47 0 235 3 pyrH Uridylate kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q1MH52 5.85e-74 228 49 0 235 3 pyrH Uridylate kinase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A7GG21 6.39e-74 227 48 1 235 3 pyrH Uridylate kinase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q215E7 6.46e-74 227 47 0 235 3 pyrH Uridylate kinase Rhodopseudomonas palustris (strain BisB18)
Q3Z9H8 7.04e-74 227 48 1 235 3 pyrH Uridylate kinase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A8MHH1 8.22e-74 227 47 1 234 3 pyrH Uridylate kinase Alkaliphilus oremlandii (strain OhILAs)
Q3ZZC3 8.85e-74 227 47 1 235 3 pyrH Uridylate kinase Dehalococcoides mccartyi (strain CBDB1)
A6TRM1 9.69e-74 227 46 1 235 3 pyrH Uridylate kinase Alkaliphilus metalliredigens (strain QYMF)
Q1MRD8 1.09e-73 227 46 1 232 3 pyrH Uridylate kinase Lawsonia intracellularis (strain PHE/MN1-00)
A8ESI8 1.36e-73 226 51 1 225 3 pyrH Uridylate kinase Aliarcobacter butzleri (strain RM4018)
Q2GLL2 1.57e-73 226 46 1 232 3 pyrH Uridylate kinase Anaplasma phagocytophilum (strain HZ)
A1B965 1.7e-73 226 46 0 238 3 pyrH Uridylate kinase Paracoccus denitrificans (strain Pd 1222)
Q2LTQ5 2e-73 226 51 1 235 3 pyrH Uridylate kinase Syntrophus aciditrophicus (strain SB)
Q3J2X5 2.04e-73 226 45 1 245 3 pyrH Uridylate kinase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJF6 2.09e-73 226 45 1 245 3 pyrH Uridylate kinase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q28PI5 2.27e-73 226 48 0 231 3 pyrH Uridylate kinase Jannaschia sp. (strain CCS1)
Q03QS3 2.29e-73 226 47 1 232 3 pyrH Uridylate kinase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q3SRH4 2.5e-73 226 46 0 235 3 pyrH Uridylate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4WUH9 2.51e-73 226 45 1 245 3 pyrH Uridylate kinase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5WFT0 2.94e-73 226 48 1 233 3 pyrH Uridylate kinase Shouchella clausii (strain KSM-K16)
P59005 3.73e-73 225 46 0 239 3 pyrH Uridylate kinase Paracoccus zeaxanthinifaciens
Q136A6 3.82e-73 225 46 0 235 3 pyrH Uridylate kinase Rhodopseudomonas palustris (strain BisB5)
Q11IJ6 4.01e-73 226 50 0 236 3 pyrH Uridylate kinase Chelativorans sp. (strain BNC1)
A8EXM4 4.68e-73 225 45 0 231 3 pyrH Uridylate kinase Rickettsia canadensis (strain McKiel)
Q03WX7 5.77e-73 225 46 1 233 3 pyrH Uridylate kinase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q4L5W0 7.02e-73 224 45 2 242 3 pyrH Uridylate kinase Staphylococcus haemolyticus (strain JCSC1435)
Q8VS53 9.84e-73 224 46 1 235 3 pyrH Uridylate kinase Limosilactobacillus reuteri
Q8CSU1 2.13e-72 223 45 2 242 3 pyrH Uridylate kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPT3 2.13e-72 223 45 2 242 3 pyrH Uridylate kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A3DE57 2.21e-72 223 44 1 234 3 pyrH Uridylate kinase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A5UUV0 2.53e-72 223 49 1 237 3 pyrH Uridylate kinase Roseiflexus sp. (strain RS-1)
A4XM00 2.83e-72 223 47 2 235 3 pyrH Uridylate kinase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q88VJ6 3.56e-72 223 45 1 232 3 pyrH Uridylate kinase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A7Z4S2 5.04e-72 223 51 1 235 3 pyrH Uridylate kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q38W66 5.38e-72 223 47 2 238 3 pyrH Uridylate kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q47S51 6.55e-72 223 50 0 232 3 pyrH Uridylate kinase Thermobifida fusca (strain YX)
Q1WUG5 8.06e-72 222 47 1 232 3 pyrH Uridylate kinase Ligilactobacillus salivarius (strain UCC118)
Q819Y0 1.15e-71 221 50 1 236 3 pyrH Uridylate kinase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P65937 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain MW2)
Q6G9V5 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain MSSA476)
Q6GHH7 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain MRSA252)
P65936 1.26e-71 221 45 1 234 1 pyrH Uridylate kinase Staphylococcus aureus (strain N315)
P65935 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGH3 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain COL)
Q2YXL0 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZ22 1.26e-71 221 45 1 234 1 pyrH Uridylate kinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHI0 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain USA300)
A7X1N6 1.26e-71 221 45 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q89KP5 1.33e-71 221 47 0 234 3 pyrH Uridylate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5VJC7 1.9e-71 221 45 1 235 3 pyrH Uridylate kinase Limosilactobacillus reuteri (strain DSM 20016)
A6QGF8 1.99e-71 221 44 1 234 3 pyrH Uridylate kinase Staphylococcus aureus (strain Newman)
Q8D2G4 5.97e-71 220 45 2 242 3 pyrH Uridylate kinase Wigglesworthia glossinidia brevipalpis
Q7MTP5 6.39e-71 219 50 0 232 3 pyrH Uridylate kinase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q81WL0 8.2e-71 219 49 1 236 3 pyrH Uridylate kinase Bacillus anthracis
Q9X5E9 8.64e-71 219 46 0 237 3 pyrH Uridylate kinase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q65JJ7 9.34e-71 219 50 1 235 3 pyrH Uridylate kinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2IW82 9.67e-71 219 46 0 235 3 pyrH Uridylate kinase Rhodopseudomonas palustris (strain HaA2)
Q8EQV1 1.1e-70 219 46 1 232 3 pyrH Uridylate kinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03FT4 1.2e-70 219 43 1 232 3 pyrH Uridylate kinase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q67PB5 3.05e-70 218 46 1 236 3 pyrH Uridylate kinase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q9LSA9 6.66e-70 220 46 2 239 1 PUMPKIN Uridylate kinase PUMPKIN, chloroplastic Arabidopsis thaliana
A5CXD7 9.85e-70 216 44 3 235 3 pyrH Uridylate kinase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0C1B9 1.14e-69 217 48 0 234 3 pyrH Uridylate kinase Hyphomonas neptunium (strain ATCC 15444)
A8YVR7 1.23e-69 216 48 1 235 3 pyrH Uridylate kinase Lactobacillus helveticus (strain DPC 4571)
O31749 1.38e-69 216 50 1 235 1 pyrH Uridylate kinase Bacillus subtilis (strain 168)
Q6M9Z8 3.74e-69 216 49 1 232 3 pyrH Uridylate kinase Protochlamydia amoebophila (strain UWE25)
Q2NBU2 3.92e-69 215 47 0 236 3 pyrH Uridylate kinase Erythrobacter litoralis (strain HTCC2594)
Q02WC4 4.01e-69 215 47 1 232 3 pyrH Uridylate kinase Lactococcus lactis subsp. cremoris (strain SK11)
Q9Z5K8 4.01e-69 215 47 1 232 3 pyrH Uridylate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CE38 4.01e-69 215 47 1 232 3 pyrH Uridylate kinase Lactococcus lactis subsp. lactis (strain IL1403)
A6QB35 4.38e-69 215 49 1 225 3 pyrH Uridylate kinase Sulfurovum sp. (strain NBC37-1)
Q7UTH1 4.8e-69 216 48 1 233 3 pyrH Uridylate kinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P43891 8.44e-69 214 50 3 232 3 pyrH Uridylate kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72KD9 8.44e-69 214 50 3 232 3 pyrH Uridylate kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q1GGR9 1.11e-68 214 46 1 232 3 pyrH Uridylate kinase Ruegeria sp. (strain TM1040)
Q04F86 1.32e-68 214 45 2 235 3 pyrH Uridylate kinase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q1BAH2 1.41e-68 214 47 1 235 3 pyrH Uridylate kinase Mycobacterium sp. (strain MCS)
A1UEJ0 1.41e-68 214 47 1 235 3 pyrH Uridylate kinase Mycobacterium sp. (strain KMS)
A3PXZ4 1.41e-68 214 47 1 235 3 pyrH Uridylate kinase Mycobacterium sp. (strain JLS)
A8GQY1 1.48e-68 214 46 0 228 3 pyrH Uridylate kinase Rickettsia rickettsii (strain Sheila Smith)
Q7VHX9 1.55e-68 213 55 1 219 3 pyrH Uridylate kinase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A1T784 2.2e-68 214 47 1 235 3 pyrH Uridylate kinase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4FMD5 3.97e-68 213 48 2 237 3 pyrH Uridylate kinase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A8I467 5.29e-68 212 51 0 232 3 pyrH Uridylate kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q7MAH8 6.27e-68 212 53 1 225 3 pyrH Uridylate kinase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q2RJP1 6.85e-68 212 47 0 237 3 pyrH Uridylate kinase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5LSV4 7.05e-68 212 46 1 232 3 pyrH Uridylate kinase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A7I2U3 8.55e-68 212 54 1 221 3 pyrH Uridylate kinase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q6YR50 2.22e-67 211 44 2 235 3 pyrH Uridylate kinase Onion yellows phytoplasma (strain OY-M)
Q9KA65 2.25e-67 211 48 1 232 3 pyrH Uridylate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A0QVD9 2.47e-67 211 46 1 239 1 pyrH Uridylate kinase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2NIS4 3.58e-67 210 44 2 235 3 pyrH Uridylate kinase Aster yellows witches'-broom phytoplasma (strain AYWB)
A0LV52 6.67e-67 210 46 1 235 3 pyrH Uridylate kinase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q0S283 7.73e-67 209 45 1 237 3 pyrH Uridylate kinase Rhodococcus jostii (strain RHA1)
P56106 1.54e-66 209 53 1 228 1 pyrH Uridylate kinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CT93 2.06e-66 208 53 1 228 3 pyrH Uridylate kinase Helicobacter pylori (strain HPAG1)
O69913 2.46e-66 208 47 2 240 3 pyrH Uridylate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82JX9 5.45e-66 207 46 2 240 3 pyrH Uridylate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9ZL66 7.53e-66 207 52 1 228 3 pyrH Uridylate kinase Helicobacter pylori (strain J99 / ATCC 700824)
Q8FP74 8.74e-66 207 47 1 232 3 pyrH Uridylate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q17Y33 1.48e-65 206 53 1 222 3 pyrH Uridylate kinase Helicobacter acinonychis (strain Sheeba)
A7H2A6 2.97e-65 205 50 1 225 3 pyrH Uridylate kinase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q1AW66 4.05e-65 205 47 2 235 3 pyrH Uridylate kinase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A1SLQ8 5.13e-65 204 46 2 233 3 pyrH Uridylate kinase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A1R4W1 6.37e-65 204 45 3 240 3 pyrH Uridylate kinase Paenarthrobacter aurescens (strain TC1)
A0QJ19 9.27e-65 205 45 1 237 3 pyrH Uridylate kinase Mycobacterium avium (strain 104)
Q9RU81 1.15e-64 204 48 3 235 3 pyrH Uridylate kinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q73VR6 1.84e-64 204 45 1 237 3 pyrH Uridylate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8G484 1.93e-64 203 47 2 232 3 pyrH Uridylate kinase Bifidobacterium longum (strain NCC 2705)
Q9PN24 2.29e-64 203 49 1 225 3 pyrH Uridylate kinase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HTI9 2.76e-64 203 49 1 225 3 pyrH Uridylate kinase Campylobacter jejuni (strain RM1221)
A1W0Q9 2.76e-64 203 49 1 225 3 pyrH Uridylate kinase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FMY0 2.76e-64 203 49 1 225 3 pyrH Uridylate kinase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q1IZI8 4.6e-64 203 47 4 242 3 pyrH Uridylate kinase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
O33045 9.78e-64 202 46 1 232 3 pyrH Uridylate kinase Mycobacterium leprae (strain TN)
Q0BNT7 1.28e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5I0 1.28e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. holarctica (strain LVS)
A7N9R6 1.28e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
P59004 1.31e-63 201 45 1 231 3 pyrH Uridylate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QF30 1.31e-63 201 45 1 231 3 pyrH Uridylate kinase Corynebacterium glutamicum (strain R)
P9WHK5 1.32e-63 202 45 1 232 1 pyrH Uridylate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHK4 1.32e-63 202 45 1 232 3 pyrH Uridylate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6N8 1.32e-63 202 45 1 232 3 pyrH Uridylate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KMM7 1.32e-63 202 45 1 232 3 pyrH Uridylate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65930 1.32e-63 202 45 1 232 3 pyrH Uridylate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0JUP3 2.38e-63 201 45 3 232 3 pyrH Uridylate kinase Arthrobacter sp. (strain FB24)
A4IZU4 2.87e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHX8 2.87e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4H3 2.87e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. novicida (strain U112)
Q14JD0 2.87e-63 201 44 2 238 3 pyrH Uridylate kinase Francisella tularensis subsp. tularensis (strain FSC 198)
A5CQS6 4.52e-63 199 44 3 236 3 pyrH Uridylate kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q4JV20 1.16e-62 199 45 1 231 3 pyrH Uridylate kinase Corynebacterium jeikeium (strain K411)
Q2GCI6 1.16e-62 198 45 1 221 3 pyrH Uridylate kinase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q30SN5 1.27e-62 198 50 1 226 3 pyrH Uridylate kinase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q185S7 1.38e-62 198 46 2 235 3 pyrH Uridylate kinase Clostridioides difficile (strain 630)
A6Q311 1.39e-62 199 48 1 226 3 pyrH Uridylate kinase Nitratiruptor sp. (strain SB155-2)
Q5YS63 1.88e-62 198 47 1 234 3 pyrH Uridylate kinase Nocardia farcinica (strain IFM 10152)
A1A1I1 2.19e-62 198 46 2 232 3 pyrH Uridylate kinase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A0RQ89 3.3e-62 197 51 1 225 3 pyrH Uridylate kinase Campylobacter fetus subsp. fetus (strain 82-40)
Q6NGK6 2.03e-61 196 43 1 237 3 pyrH Uridylate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2J528 2.16e-60 194 42 2 234 3 pyrH Uridylate kinase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0RBL9 2.58e-59 191 42 2 233 3 pyrH Uridylate kinase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q4A587 1.01e-57 186 40 3 236 3 pyrH Uridylate kinase Mycoplasmopsis synoviae (strain 53)
A5ILX9 1.07e-56 183 41 1 232 3 pyrH Uridylate kinase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A8F5E8 1.44e-56 183 39 1 235 3 pyrH Uridylate kinase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q9X1U0 3.49e-56 182 41 1 232 3 pyrH Uridylate kinase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q83G72 3.89e-56 182 45 4 233 3 pyrH Uridylate kinase Tropheryma whipplei (strain Twist)
Q83HZ6 3.89e-56 182 45 4 233 3 pyrH Uridylate kinase Tropheryma whipplei (strain TW08/27)
Q6F0Q9 4.45e-56 182 42 4 239 3 pyrH Uridylate kinase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q252Q5 5.62e-56 182 41 3 234 3 pyrH Uridylate kinase Chlamydia felis (strain Fe/C-56)
Q5L765 6.36e-56 182 42 3 231 3 pyrH Uridylate kinase Chlamydia abortus (strain DSM 27085 / S26/3)
Q824U5 6.9e-56 181 42 3 234 3 pyrH Uridylate kinase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q2SSA5 1.6e-55 180 40 3 233 3 pyrH Uridylate kinase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6AEV5 1.77e-55 180 41 3 231 3 pyrH Uridylate kinase Leifsonia xyli subsp. xyli (strain CTCB07)
Q6A7J9 1.14e-54 178 45 2 234 3 pyrH Uridylate kinase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q9Z7K7 3.19e-54 177 40 3 235 3 pyrH Uridylate kinase Chlamydia pneumoniae
Q98QZ0 3.69e-54 177 39 3 231 3 pyrH Uridylate kinase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q9PPX6 8.61e-54 176 38 2 233 1 pyrH Uridylate kinase Ureaplasma parvum serovar 3 (strain ATCC 700970)
A7HL98 3.65e-53 174 38 1 232 3 pyrH Uridylate kinase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q4A9E9 1.59e-51 170 37 3 222 3 pyrH Uridylate kinase Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A7I8 1.59e-51 170 37 3 222 3 pyrH Uridylate kinase Mesomycoplasma hyopneumoniae (strain 7448)
Q600A4 1.59e-51 170 37 3 222 3 pyrH Uridylate kinase Mesomycoplasma hyopneumoniae (strain 232)
Q6KIN6 2.51e-51 170 38 4 238 3 pyrH Uridylate kinase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A6LK98 9.56e-51 168 37 1 232 3 pyrH Uridylate kinase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A5CD80 3.81e-50 167 38 3 237 3 pyrH Uridylate kinase Orientia tsutsugamushi (strain Boryong)
O84685 1.29e-45 155 40 3 220 3 pyrH Uridylate kinase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KL16 1.41e-45 155 39 3 220 3 pyrH Uridylate kinase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
P71147 3.24e-45 154 40 3 220 3 pyrH Uridylate kinase Chlamydia muridarum (strain MoPn / Nigg)
Q8EUG9 4.35e-45 156 36 3 232 3 pyrH Uridylate kinase Malacoplasma penetrans (strain HF-2)
Q7NC20 8.51e-45 153 34 3 231 3 pyrH Uridylate kinase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P75165 1.38e-39 139 33 3 233 3 pyrH Uridylate kinase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47672 2.26e-32 121 34 3 244 3 pyrH Uridylate kinase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
O28237 1.33e-17 81 32 6 226 1 pyrH Uridylate kinase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A2BLM0 2.61e-17 81 28 6 239 3 pyrH Uridylate kinase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
A6VJ20 3.16e-16 78 32 5 184 3 pyrH Uridylate kinase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A4FZB7 1.43e-15 76 32 5 184 3 pyrH Uridylate kinase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A9A6R4 2.75e-15 75 32 5 184 3 pyrH Uridylate kinase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_08330
Feature type CDS
Gene pyrH
Product UMP kinase
Location 189699 - 190427 (strand: 1)
Length 729 (nucleotides) / 242 (amino acids)

Contig

Accession ZDB_364
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1060
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00696 Amino acid kinase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0528 Nucleotide transport and metabolism (F) F Uridylate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MATNAKPVYQRILLKLSGEALQGNEGFGIDATVLDRMAQEIKELVELQIQVGVVIGGGNLFRGAGLAEAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHGRVVIFSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVYSADPAKDPDAVLYEKLNYQDVLERELKVMDLAAFTLARDHNLPIRVFNMNKPGALRRVVMGENEGTLISRD

Flanking regions ( +/- flanking 50bp)

TCCGTCCGGGTATCTCTGGCAATAAATTCATCTGTTTAGGACAGAACACCATGGCTACCAATGCAAAACCTGTTTATCAACGTATTCTGCTGAAGCTCAGTGGCGAGGCTTTACAAGGGAATGAAGGTTTCGGAATTGATGCGACTGTACTTGACCGTATGGCGCAGGAAATTAAGGAACTGGTTGAACTGCAGATTCAGGTCGGTGTCGTTATTGGCGGGGGCAATCTGTTTCGCGGCGCAGGGCTGGCCGAAGCCGGTATGAACCGCGTTGTCGGTGACCATATGGGTATGCTGGCAACCGTGATGAACGGTCTGGCAATGCGTGATGCACTTCATCGCGCTTATGTGAATGCGCGGCTGATGTCTGCGATTCCGCTCAACGGCGTTTGTGACAACTACAGCTGGGCTGAGGCAATCAGTCTTTTACGTCACGGCCGTGTGGTTATTTTTTCTGCCGGAACAGGCAACCCATTCTTTACCACGGATTCTGCGGCCTGTCTGCGCGGGATCGAAATTGAAGCGGATGTGGTGCTGAAAGCCACAAAAGTGGATGGTGTTTACTCAGCCGATCCGGCCAAAGACCCGGATGCGGTGCTGTATGAAAAACTCAACTATCAGGATGTGCTGGAACGCGAACTGAAAGTGATGGATCTGGCGGCCTTTACCCTGGCCCGTGACCATAACCTGCCAATCCGTGTTTTCAACATGAACAAACCCGGTGCATTACGCCGTGTCGTGATGGGCGAGAACGAAGGTACCTTGATTTCGCGTGACTAAACGCCGGGACACCGGCGGAATTTGACGGTATCATTTATAAATCGATTCGC