Homologs in group_1208

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06575 FBDBKF_06575 100.0 Morganella morganii S1 trpR trp operon repressor
EHELCC_09620 EHELCC_09620 100.0 Morganella morganii S2 trpR trp operon repressor
NLDBIP_10000 NLDBIP_10000 100.0 Morganella morganii S4 trpR trp operon repressor
HKOGLL_07305 HKOGLL_07305 100.0 Morganella morganii S5 trpR trp operon repressor
F4V73_RS15365 F4V73_RS15365 88.1 Morganella psychrotolerans trpR trp operon repressor
PMI_RS18480 PMI_RS18480 66.3 Proteus mirabilis HI4320 trpR trp operon repressor

Distribution of the homologs in the orthogroup group_1208

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1208

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N902 9.76e-43 138 63 1 105 3 trpR Trp operon repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G9J2 1.77e-41 135 70 0 90 3 trpR Trp operon repressor Serratia proteamaculans (strain 568)
A9MR96 3.89e-38 126 68 0 88 3 trpR Trp operon repressor Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5Y266 1.84e-37 124 69 0 92 3 trpR Trp operon repressor Klebsiella pneumoniae (strain 342)
Q66EU5 3.34e-37 124 68 0 91 3 trpR Trp operon repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
P58700 3.34e-37 124 68 0 91 3 trpR Trp operon repressor Yersinia pestis
A6TI07 3.43e-37 124 69 0 92 3 trpR Trp operon repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P39439 4.99e-37 123 70 0 91 3 trpR Trp operon repressor Klebsiella aerogenes
P58699 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella typhi
B5BAK9 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella paratyphi A (strain AKU_12601)
C0Q8F3 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella paratyphi C (strain RKS4594)
Q5PK31 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57G28 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella choleraesuis (strain SC-B67)
B5F541 8.92e-37 123 70 0 91 3 trpR Trp operon repressor Salmonella agona (strain SL483)
C6DF27 1.07e-36 123 68 1 96 3 trpR Trp operon repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0A0 1.87e-36 122 68 1 96 3 trpR Trp operon repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YU01 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella sonnei (strain Ss046)
P0A883 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella flexneri
Q0SX19 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella flexneri serotype 5b (strain 8401)
Q327K2 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31SU5 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella boydii serotype 4 (strain Sb227)
B2TZS6 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I6P1 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain SE11)
P0A881 2.36e-36 122 71 0 88 1 trpR Trp operon repressor Escherichia coli (strain K12)
B1IS26 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A8C2 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O9:H4 (strain HS)
B1XFK3 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain K12 / DH10B)
C4ZT75 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXV6 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O8 (strain IAI1)
B5Z4S5 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A882 2.36e-36 122 71 0 88 1 trpR Trp operon repressor Escherichia coli O157:H7
B7LEN9 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain 55989 / EAEC)
A7ZVT5 2.36e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LNT5 2.52e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NH68 2.52e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NW74 2.52e-36 122 71 0 88 3 trpR Trp operon repressor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9N7F3 3.79e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R3B5 4e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella enteritidis PT4 (strain P125109)
P37444 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TU53 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella schwarzengrund (strain CVM19633)
B4T4I7 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella newport (strain SL254)
B4TH16 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella heidelberg (strain SL476)
B5R9W1 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FTD7 4.18e-36 121 69 0 91 3 trpR Trp operon repressor Salmonella dublin (strain CT_02021853)
B1LEK0 4.76e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain SMS-3-5 / SECEC)
Q1R248 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli (strain UTI89 / UPEC)
Q8FA42 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8R8 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJW2 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O1:K1 / APEC
B7N2W3 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O81 (strain ED1a)
B7MNK2 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UR23 5.03e-36 121 71 0 88 3 trpR Trp operon repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P39440 5.78e-36 120 68 0 92 3 trpR Trp operon repressor Enterobacter cloacae
A1JJB6 8.46e-36 120 61 1 103 3 trpR Trp operon repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MIH6 2.8e-35 119 67 0 94 3 trpR Trp operon repressor Cronobacter sakazakii (strain ATCC BAA-894)
Q2NVZ9 1.4e-32 112 60 0 89 3 trpR Trp operon repressor Sodalis glossinidius (strain morsitans)
Q7MNK8 1.25e-25 94 53 1 93 3 trpR Trp operon repressor homolog Vibrio vulnificus (strain YJ016)
Q8DEU5 1.25e-25 94 53 1 93 3 trpR Trp operon repressor homolog Vibrio vulnificus (strain CMCP6)
B6EGC9 8.18e-25 92 52 0 84 3 trpR Trp operon repressor homolog Aliivibrio salmonicida (strain LFI1238)
Q9KU28 3.11e-24 91 52 0 89 3 trpR Trp operon repressor homolog Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FAQ3 1.28e-23 89 52 0 84 3 trpR Trp operon repressor homolog Aliivibrio fischeri (strain MJ11)
Q5E7E2 1.38e-23 89 52 0 84 3 trpR Trp operon repressor homolog Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LUG2 4.52e-23 88 50 0 84 3 trpR Trp operon repressor homolog Photobacterium profundum (strain SS9)
Q9CNU9 6.31e-22 85 45 0 86 3 trpR Trp operon repressor homolog Pasteurella multocida (strain Pm70)
B7VJN4 9.99e-22 84 46 0 88 3 trpR Trp operon repressor homolog Vibrio atlanticus (strain LGP32)
Q87S71 1.62e-21 84 49 1 89 3 trpR Trp operon repressor homolog Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MTC2 2.05e-21 84 48 1 89 3 trpR Trp operon repressor homolog Vibrio campbellii (strain ATCC BAA-1116)
A6VPL3 2.14e-18 76 41 0 86 3 trpR Trp operon repressor homolog Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0I456 1.76e-16 71 43 0 91 3 trpR Trp operon repressor homolog Histophilus somni (strain 129Pt)
P44889 2.05e-16 71 38 0 86 3 trpR Trp operon repressor homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHY0 2.05e-16 71 38 0 86 3 trpR Trp operon repressor homolog Haemophilus influenzae (strain PittGG)
A5UDP4 2.05e-16 71 38 0 86 3 trpR Trp operon repressor homolog Haemophilus influenzae (strain PittEE)
Q4QM70 2.05e-16 71 38 0 86 3 trpR Trp operon repressor homolog Haemophilus influenzae (strain 86-028NP)
B0UT98 2.21e-16 71 43 0 91 3 trpR Trp operon repressor homolog Histophilus somni (strain 2336)
B0BBF0 4.58e-15 67 36 0 90 3 trpR Trp operon repressor homolog Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9S0 4.58e-15 67 36 0 90 3 trpR Trp operon repressor homolog Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q65S87 8.53e-15 67 44 0 84 3 trpR Trp operon repressor homolog Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
O84171 1.03e-14 66 36 0 90 3 trpR Trp operon repressor homolog Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KMJ6 1.03e-14 66 36 0 90 3 trpR Trp operon repressor homolog Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q254S6 2.92e-12 60 35 0 88 3 trpR Trp operon repressor homolog Chlamydia felis (strain Fe/C-56)
Q822W7 1.03e-10 56 34 0 86 3 trpR Trp operon repressor homolog Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PC61 3.37e-07 47 32 1 86 3 trpR Trp operon repressor homolog Xylella fastidiosa (strain 9a5c)
Q87D16 4.27e-07 47 32 1 86 3 trpR Trp operon repressor homolog Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4R3 4.27e-07 47 32 1 86 3 trpR Trp operon repressor homolog Xylella fastidiosa (strain M23)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_07755
Feature type CDS
Gene trpR
Product trp operon repressor
Location 61961 - 62266 (strand: 1)
Length 306 (nucleotides) / 101 (amino acids)
In genomic island -

Contig

Accession ZDB_364
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1208
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01371 Trp repressor protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2973 Transcription (K) K Trp operon repressor

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03720 TrpR family transcriptional regulator, trp operon repressor - -

Protein Sequence

MTTDQLQDSDWQRFVSLLRNAYSQDIESHLFQLLFTPDERTALGTRVRIVEELLRGKMSQRELKSELGVGIATITRGSNSLKYAPEEVKAWLEQELLSGKK

Flanking regions ( +/- flanking 50bp)

TGTACTAGTTAACGGGTACTTTTTGTACTCCCGATCCTATGGGGTGACACATGACGACAGACCAACTTCAGGACAGCGACTGGCAGCGCTTTGTCAGCCTGCTGCGCAATGCCTATTCACAGGATATTGAATCCCACCTTTTTCAGCTGCTTTTTACCCCGGATGAGCGCACAGCGCTGGGCACACGCGTGCGGATCGTCGAGGAACTGCTGCGCGGTAAGATGAGTCAGCGTGAGCTGAAAAGTGAGCTGGGGGTCGGCATTGCGACCATCACCCGCGGCTCCAACAGCCTGAAATATGCCCCGGAAGAGGTGAAAGCCTGGCTGGAGCAGGAACTCCTCAGCGGCAAAAAATAACTCAGCTGTTCTGCCGCCGGTATGTTGTCAGAGAAATACCTGTTTCCCGT