Homologs in group_878

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04515 FBDBKF_04515 100.0 Morganella morganii S1 speB agmatinase
EHELCC_05805 EHELCC_05805 100.0 Morganella morganii S2 speB agmatinase
NLDBIP_06125 NLDBIP_06125 100.0 Morganella morganii S4 speB agmatinase
HKOGLL_06480 HKOGLL_06480 100.0 Morganella morganii S5 speB agmatinase
F4V73_RS08955 F4V73_RS08955 98.4 Morganella psychrotolerans speB agmatinase
PMI_RS10310 PMI_RS10310 88.9 Proteus mirabilis HI4320 speB agmatinase

Distribution of the homologs in the orthogroup group_878

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_878

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7X3P1 0.0 580 88 0 306 3 speB Agmatinase Proteus mirabilis
B4F1A3 0.0 580 88 0 306 3 speB Agmatinase Proteus mirabilis (strain HI4320)
Q7N122 0.0 558 86 0 306 3 speB Agmatinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GIX7 0.0 552 84 0 303 3 speB Agmatinase Serratia proteamaculans (strain 568)
B2U0V8 0.0 539 86 0 304 3 speB Agmatinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TDU9 0.0 537 86 0 304 3 speB Agmatinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XUB2 0.0 537 86 0 304 3 speB Agmatinase Klebsiella pneumoniae (strain 342)
A4WE75 0.0 537 86 0 304 3 speB Agmatinase Enterobacter sp. (strain 638)
P60657 0.0 537 86 0 304 3 speB Agmatinase Shigella flexneri
Q0T0V7 0.0 537 86 0 304 3 speB Agmatinase Shigella flexneri serotype 5b (strain 8401)
Q31WK0 0.0 537 86 0 304 3 speB Agmatinase Shigella boydii serotype 4 (strain Sb227)
B7LPE7 0.0 537 86 0 304 3 speB Agmatinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LDE6 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain SMS-3-5 / SECEC)
B6I775 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain SE11)
B7N7I9 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60651 0.0 537 86 0 304 1 speB Agmatinase Escherichia coli (strain K12)
B1IT67 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XF99 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain K12 / DH10B)
C5A0K6 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYW6 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli O8 (strain IAI1)
B5YQD4 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60652 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli O157:H7
B7LFJ6 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli (strain 55989 / EAEC)
A7ZR59 0.0 537 86 0 304 3 speB Agmatinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R791 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli (strain UTI89 / UPEC)
Q8FE36 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDR4 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFC5 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O1:K1 / APEC
B7MZN5 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O81 (strain ED1a)
B7MMC5 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHY3 0.0 536 86 0 304 3 speB Agmatinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YXT4 0.0 536 86 0 304 3 speB Agmatinase Shigella sonnei (strain Ss046)
A7MJQ1 0.0 536 86 0 304 3 speB Agmatinase Cronobacter sakazakii (strain ATCC BAA-894)
B7NI01 0.0 535 86 0 304 3 speB Agmatinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32C02 0.0 535 86 0 303 3 speB Agmatinase Shigella dysenteriae serotype 1 (strain Sd197)
A8A477 0.0 535 86 0 304 3 speB Agmatinase Escherichia coli O9:H4 (strain HS)
Q2NRD3 0.0 534 82 0 304 3 speB Agmatinase Sodalis glossinidius (strain morsitans)
A8APF8 0.0 533 85 0 304 3 speB Agmatinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5RE39 0.0 531 85 0 304 3 speB Agmatinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXK5 0.0 531 85 0 304 3 speB Agmatinase Salmonella enteritidis PT4 (strain P125109)
B5FUJ0 0.0 531 85 0 304 3 speB Agmatinase Salmonella dublin (strain CT_02021853)
P60656 0.0 531 85 0 304 3 speB Agmatinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60655 0.0 531 85 0 304 3 speB Agmatinase Salmonella typhi
B4TV53 0.0 531 85 0 304 3 speB Agmatinase Salmonella schwarzengrund (strain CVM19633)
B5BFP3 0.0 531 85 0 304 3 speB Agmatinase Salmonella paratyphi A (strain AKU_12601)
C0PY54 0.0 531 85 0 304 3 speB Agmatinase Salmonella paratyphi C (strain RKS4594)
A9N3R6 0.0 531 85 0 304 3 speB Agmatinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJH7 0.0 531 85 0 304 3 speB Agmatinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5I5 0.0 531 85 0 304 3 speB Agmatinase Salmonella newport (strain SL254)
B4THG3 0.0 531 85 0 304 3 speB Agmatinase Salmonella heidelberg (strain SL476)
Q57K36 0.0 531 85 0 304 3 speB Agmatinase Salmonella choleraesuis (strain SC-B67)
B5F5K3 0.0 531 85 0 304 3 speB Agmatinase Salmonella agona (strain SL483)
C5BAV1 0.0 528 84 0 303 3 speB Agmatinase Edwardsiella ictaluri (strain 93-146)
A1KVF9 8.25e-175 488 73 0 306 3 speB Agmatinase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M254 8.25e-175 488 73 0 306 3 speB Agmatinase Neisseria meningitidis serogroup C (strain 053442)
P60654 1.61e-174 488 73 0 306 3 speB Agmatinase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P60653 1.61e-174 488 73 0 306 3 speB Agmatinase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RP98 1.94e-173 485 72 0 306 3 speB Agmatinase Neisseria gonorrhoeae (strain NCCP11945)
Q5F6R3 1.94e-173 485 72 0 306 3 speB Agmatinase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7VRG4 4.26e-137 393 59 0 300 3 speB Agmatinase Blochmanniella floridana
Q7P0S6 1.65e-88 270 51 5 303 3 speB Agmatinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9BSE5 3.96e-64 208 42 5 290 1 AGMAT Guanidino acid hydrolase, mitochondrial Homo sapiens
Q90XD2 5.52e-64 208 42 5 297 2 AGMAT Agmatinase, mitochondrial Gallus gallus
Q9I3S3 9.82e-62 201 41 5 291 1 gbuA Guanidinobutyrase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DJQ3 1.03e-59 196 41 5 294 1 pah Proclavaminate amidinohydrolase Streptomyces clavuligerus
Q9I6K2 1.37e-58 193 40 7 297 1 gpuA Guanidinopropionase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KZT5 3.5e-58 193 37 8 315 1 gbh Guanidinobutyrase Arthrobacter sp. (strain KUJ 8602)
A2AS89 5.62e-58 193 41 5 290 1 Agmat Guanidino acid hydrolase, mitochondrial Mus musculus
Q0D2L3 7.81e-58 192 40 5 290 2 Agmat Guanidino acid hydrolase, mitochondrial Rattus norvegicus
Q9C0Y9 6.84e-56 189 35 7 320 3 SPAPB24D3.03 Putative agmatinase 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q10088 1.27e-53 182 34 8 336 3 SPAC11D3.09 Putative agmatinase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6CIB4 8.26e-53 181 36 9 307 1 GBU1 Guanidinobutyrase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
O42887 1.5e-47 167 35 10 315 3 SPBC8E4.03 Putative agmatinase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q81JT1 4.89e-47 162 36 4 275 3 speB Agmatinase Bacillus anthracis
P70999 4.41e-46 160 34 4 275 1 speB Agmatinase Bacillus subtilis (strain 168)
Q814Q2 1e-45 159 35 4 275 3 speB Agmatinase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9K6B9 7.86e-42 149 34 4 266 3 speB Agmatinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P73270 8.7e-37 138 32 7 294 1 gdmH Guanidine hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q57757 2.58e-33 126 31 11 284 1 speB Agmatinase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P19268 7.16e-33 125 29 10 293 3 None Uncharacterized 32.2 kDa protein in hmfB 3'region Methanothermus fervidus
Q72JK8 1.33e-28 114 30 9 262 1 TT_C0764 N(1)-aminopropylagmatine ureohydrolase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SJ85 7.26e-28 112 30 9 262 1 TTHA1129 N(1)-aminopropylagmatine ureohydrolase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5JI38 8.55e-22 95 30 12 282 1 TK0882 N(1)-aminopropylagmatine ureohydrolase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P53608 6.02e-20 91 28 11 293 1 rocF Arginase Bacillus caldovelox
P46637 6.68e-20 91 29 12 284 1 ARGAH1 Arginase 1, mitochondrial Arabidopsis thaliana
P78540 1.64e-19 90 26 11 313 1 ARG2 Arginase-2, mitochondrial Homo sapiens
O08701 1.69e-19 90 25 10 313 1 Arg2 Arginase-2, mitochondrial Rattus norvegicus
O57839 4.21e-19 88 29 10 256 1 PH0083 Agmatinase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q58DL1 1.22e-17 85 25 11 339 2 ARG2 Arginase-2, mitochondrial Bos taurus
Q9KBE3 1.31e-17 85 27 11 292 3 hutG Formimidoylglutamase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
G7JFU5 2.13e-17 84 27 13 327 1 ARGAH Arginase, mitochondrial Medicago truncatula
Q91554 4.47e-17 84 26 13 326 2 arg2-b Arginase, non-hepatic 2 Xenopus laevis
P72703 6.22e-17 82 27 11 287 1 speB1 N(1)-aminopropylagmatine ureohydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O08691 6.7e-17 83 24 10 313 1 Arg2 Arginase-2, mitochondrial Mus musculus
Q91553 6.71e-17 83 25 10 313 2 arg2-a Arginase, non-hepatic 1 Xenopus laevis
Q91555 6.84e-17 83 27 14 342 2 arg2-c Arginase, non-hepatic 3 Xenopus laevis
Q9ZPF5 3.9e-16 81 27 11 284 1 ARGAH2 Arginase 2, chloroplastic/mitochondrial Arabidopsis thaliana
P42068 4.05e-16 80 26 10 284 1 hutG Formimidoylglutamase Bacillus subtilis (strain 168)
Q7X7N2 4.44e-16 80 29 13 285 2 ARG1 Arginase 1, mitochondrial Oryza sativa subsp. japonica
B8AU84 4.89e-16 80 28 12 282 1 B0616E02-H0507E05.7 Arginase 1, mitochondrial Oryza sativa subsp. indica
P49900 1.15e-15 79 26 12 302 2 None Arginase, hepatic Aquarana catesbeiana
Q4VK78 1.18e-15 79 26 11 308 2 ARG2 Arginase-2, mitochondrial Oryctolagus cuniculus
Q2KJ64 3.77e-15 78 25 13 317 2 ARG1 Arginase-1 Bos taurus
P05089 4.03e-15 77 25 12 312 1 ARG1 Arginase-1 Homo sapiens
Q6GER3 1.04e-14 76 27 12 295 3 arg Arginase Staphylococcus aureus (strain MRSA252)
P07824 1.28e-14 76 24 12 315 1 Arg1 Arginase-1 Rattus norvegicus
Q61176 6.73e-14 74 24 12 312 1 Arg1 Arginase-1 Mus musculus
Q95KM0 7.77e-14 74 24 12 312 2 ARG1 Arginase-1 Oryctolagus cuniculus
P40906 8.55e-14 73 29 8 213 3 ARG Arginase Coccidioides posadasii (strain C735)
Q1E180 8.97e-14 73 29 8 213 3 ARG Arginase Coccidioides immitis (strain RS)
Q5ZXM2 2.01e-13 73 24 6 285 3 hutG Formimidoylglutamase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X741 2.03e-13 73 24 6 285 3 hutG Formimidoylglutamase Legionella pneumophila (strain Paris)
Q5WYJ0 2.78e-13 72 24 6 285 3 hutG Formimidoylglutamase Legionella pneumophila (strain Lens)
Q95JC8 3.86e-13 72 24 12 315 2 ARG1 Arginase-1 Sus scrofa
Q8NVE3 4.23e-13 72 28 8 228 3 arg Arginase Staphylococcus aureus (strain MW2)
Q6G7E9 4.23e-13 72 28 8 228 3 arg Arginase Staphylococcus aureus (strain MSSA476)
P60088 4.23e-13 72 28 8 228 1 arg Arginase Staphylococcus aureus (strain N315)
P60087 4.23e-13 72 28 8 228 3 arg Arginase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P60086 4.23e-13 72 28 8 228 3 arg Arginase Staphylococcus aureus (strain COL)
P39138 1.4e-12 70 24 8 294 1 rocF Arginase Bacillus subtilis (strain 168)
O49046 1.63e-12 70 27 11 284 2 AG1 Arginase Glycine max
Q9HQD7 1.7e-12 70 29 10 309 3 hutG Formimidoylglutamase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R542 1.7e-12 70 29 10 309 3 hutG Formimidoylglutamase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
A4SSN4 2.72e-12 69 24 6 266 3 hutG Formimidoylglutamase Aeromonas salmonicida (strain A449)
Q7M0Z3 4e-12 68 24 9 293 1 rocF Arginase Brevibacillus brevis
B1HQK2 1.24e-11 67 26 9 267 3 hutG Formimidoylglutamase Lysinibacillus sphaericus (strain C3-41)
Q6CLS8 8.19e-11 65 27 6 200 1 CAR1 Arginase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q12611 1.49e-10 64 27 9 213 3 agaA Arginase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B7V9J1 4.04e-10 63 24 12 293 3 PLES_18931 Formimidoylglutamase Pseudomonas aeruginosa (strain LESB58)
Q471H6 4.53e-10 63 25 10 275 3 hutG Formimidoylglutamase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P33280 6.2e-10 62 26 7 210 1 aga-1 Arginase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0KF85 6.8e-10 62 24 8 270 3 hutG Formimidoylglutamase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q02PY1 1.02e-09 62 25 14 296 3 PA14_23170 Formimidoylglutamase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q2SEP7 1.03e-09 62 25 11 283 3 hutG Formimidoylglutamase Hahella chejuensis (strain KCTC 2396)
A8Z523 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain USA300 / TCH1516)
P99158 1.22e-09 61 23 6 252 1 hutG Formimidoylglutamase Staphylococcus aureus (strain N315)
P63570 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJH5 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain Newman)
Q5HDM3 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain COL)
A5IVB6 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain JH9)
Q2FVT2 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEG2 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain USA300)
A6U459 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain JH1)
A7X5U0 1.22e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain Mu3 / ATCC 700698)
P00812 1.3e-09 62 27 7 217 1 CAR1 Arginase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q74ZW4 1.51e-09 62 26 7 209 3 CAR1 Arginase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A6V2Q0 1.89e-09 61 24 13 303 3 PSPA7_1954 Formimidoylglutamase Pseudomonas aeruginosa (strain PA7)
A0A2R2JFW7 1.92e-09 61 26 8 208 1 None Arginase Glaciozyma antarctica (strain PI12)
Q8NV63 1.98e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain MW2)
Q6G6Y7 1.98e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain MSSA476)
Q2YYV4 2.14e-09 61 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9HZ59 2.24e-09 60 25 14 296 1 PA3175 Formimidoylglutamase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6GEA1 4.21e-09 60 23 6 252 3 hutG Formimidoylglutamase Staphylococcus aureus (strain MRSA252)
Q8I384 1.5e-08 58 26 8 196 1 ARG Arginase Plasmodium falciparum (isolate 3D7)
P60109 1.9e-08 58 27 10 278 3 hutG Formimidoylglutamase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8CNA3 2.6e-08 57 23 6 253 3 hutG Formimidoylglutamase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLR4 2.6e-08 57 23 6 253 3 hutG Formimidoylglutamase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0A509AF89 2.63e-08 58 25 9 226 3 ARG Arginase Plasmodium berghei (strain Anka)
Q5E0C4 3.09e-08 57 24 10 291 3 hutG Formimidoylglutamase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P30759 3.47e-08 57 26 11 257 2 arg1 Arginase-1 Xenopus laevis
Q8FQ76 4.13e-08 57 26 9 265 3 hutG Formimidoylglutamase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B9DLS6 4.34e-08 57 24 8 254 3 hutG Formimidoylglutamase Staphylococcus carnosus (strain TM300)
P60111 6.58e-08 56 24 11 284 3 hutG Formimidoylglutamase Vibrio vulnificus (strain YJ016)
Q8Z899 7.83e-08 56 23 10 269 3 hutG Formimidoylglutamase Salmonella typhi
Q5NZY1 9.05e-08 56 25 14 297 3 hutG Formimidoylglutamase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B4SZJ1 1.19e-07 55 23 10 269 3 hutG Formimidoylglutamase Salmonella newport (strain SL254)
A2RGS6 1.58e-07 55 24 9 279 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q13PQ0 1.6e-07 55 27 13 288 3 hutG Formimidoylglutamase Paraburkholderia xenovorans (strain LB400)
A9MTJ4 2.4e-07 55 23 10 269 3 hutG Formimidoylglutamase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C0PWX6 3.15e-07 54 23 10 269 3 hutG Formimidoylglutamase Salmonella paratyphi C (strain RKS4594)
Q57RG9 3.15e-07 54 23 10 269 3 hutG Formimidoylglutamase Salmonella choleraesuis (strain SC-B67)
C3LLQ0 3.66e-07 54 23 11 277 3 hutG Formimidoylglutamase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSQ2 3.66e-07 54 23 11 277 1 hutG Formimidoylglutamase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1X7 3.66e-07 54 23 11 277 3 hutG Formimidoylglutamase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5BC36 4.04e-07 54 23 10 270 3 hutG Formimidoylglutamase Salmonella paratyphi A (strain AKU_12601)
Q5PG59 4.04e-07 54 23 10 270 3 hutG Formimidoylglutamase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R755 8.46e-07 53 23 10 269 3 hutG Formimidoylglutamase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX59 8.46e-07 53 23 10 269 3 hutG Formimidoylglutamase Salmonella enteritidis PT4 (strain P125109)
B5FP55 8.46e-07 53 23 10 269 3 hutG Formimidoylglutamase Salmonella dublin (strain CT_02021853)
Q8ZQR1 9.01e-07 53 23 10 269 3 hutG Formimidoylglutamase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TC42 9.01e-07 53 23 10 269 3 hutG Formimidoylglutamase Salmonella heidelberg (strain SL476)
A8AZ72 1.04e-06 53 24 9 269 3 hutG Formimidoylglutamase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P14012 1.05e-06 53 26 9 209 2 arcA Arginase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DA19 1.13e-06 53 24 11 284 3 hutG Formimidoylglutamase Vibrio vulnificus (strain CMCP6)
P0CZ67 1.14e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q1J4B6 1.14e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEK0 1.14e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M2 (strain MGAS10270)
P0CZ66 1.14e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1JJJ7 1.23e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9E8 1.23e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8NZ45 1.23e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q48QY8 1.46e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M28 (strain MGAS6180)
B5XIY3 1.61e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M49 (strain NZ131)
Q99XQ9 1.61e-06 52 24 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M1
P0A2Y0 1.99e-06 52 30 10 196 3 arcB Arginase Brucella suis biovar 1 (strain 1330)
P0A2X9 1.99e-06 52 30 10 196 3 arcB Arginase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A2Y1 1.99e-06 52 30 10 196 3 arcB Arginase Brucella abortus biovar 1 (strain 9-941)
B4TQT3 2.07e-06 52 23 11 273 3 hutG Formimidoylglutamase Salmonella schwarzengrund (strain CVM19633)
B5F066 2.09e-06 52 23 10 269 3 hutG Formimidoylglutamase Salmonella agona (strain SL483)
Q5X9K2 2.28e-06 52 23 8 275 3 hutG Formimidoylglutamase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q4L8J3 2.31e-06 52 22 8 267 3 hutG Formimidoylglutamase Staphylococcus haemolyticus (strain JCSC1435)
A9MJF2 2.82e-06 51 22 11 273 3 hutG Formimidoylglutamase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B2TFB8 5.07e-06 50 26 10 263 3 hutG Formimidoylglutamase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B9E7J8 8.03e-06 50 25 9 256 3 hutG Formimidoylglutamase Macrococcus caseolyticus (strain JCSC5402)
P37818 8.67e-06 50 23 7 205 3 car1 Arginase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8XW30 1.38e-05 49 26 9 227 3 hutG Formimidoylglutamase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0KFM5 2.16e-05 48 27 11 274 3 hutG Formimidoylglutamase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4IMP1 2.26e-05 48 25 9 242 3 hutG Formimidoylglutamase Geobacillus thermodenitrificans (strain NG80-2)
Q5L086 2.31e-05 48 24 7 240 3 hutG Formimidoylglutamase Geobacillus kaustophilus (strain HTA426)
C4LSS0 2.34e-05 48 26 6 189 1 ARG Arginase Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
B5XZ82 3.67e-05 48 24 12 302 3 hutG Formimidoylglutamase Klebsiella pneumoniae (strain 342)
Q10066 4.75e-05 48 43 1 55 3 aru1 Arginase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q87Q75 5.54e-05 47 22 12 292 3 hutG Formimidoylglutamase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C1BBD1 5.69e-05 47 24 9 262 3 hutG Formimidoylglutamase Rhodococcus opacus (strain B4)
P60110 0.000122 46 22 11 322 3 hutG Formimidoylglutamase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5DA16 0.000129 46 22 9 271 3 hutG Formimidoylglutamase Geobacillus sp. (strain WCH70)
Q7WJ55 0.000765 44 25 10 278 3 hutG Formimidoylglutamase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_03005
Feature type CDS
Gene speB
Product agmatinase
Location 176427 - 177350 (strand: -1)
Length 924 (nucleotides) / 307 (amino acids)

Contig

Accession ZDB_360
Length 302856 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_878
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00491 Arginase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0010 Amino acid transport and metabolism (E) E Arginase/agmatinase family enzyme

Kegg Ortholog Annotation(s)

Protein Sequence

MINSTLGNQTDNSLVSNAFGFLRLPLNFQPYTSDADWVITGVPFDMATSGRAGSRHGPAAIRQISTNLAWEGNRWPWTFDMRERLNVVDCGDLVFAFGDAQDMSDKLQAHTEKVLASGKKCLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYGNGSKFDHGTMFYHAPNEGLIDPAHSVQIGIRTEHETDNGFTVIDAAQVNDRTVDDVIAQVKAIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGLQPLNIVGMDLVEVAPAYDQSDITALAGATIALEMLYLQAAKKG

Flanking regions ( +/- flanking 50bp)

ATTTATTACGTCCGGTTTTGTGTCAGTAAGACATTGATAAAGGAATCATTATGATTAACAGCACATTAGGCAATCAGACCGATAACTCACTGGTCTCTAATGCGTTTGGTTTTCTCCGCCTGCCGCTGAATTTCCAGCCGTACACCAGTGACGCTGACTGGGTGATCACCGGTGTTCCGTTTGATATGGCGACCTCCGGCCGCGCGGGTTCCCGTCACGGACCTGCAGCCATCCGTCAGATTTCAACCAATCTGGCCTGGGAAGGTAACCGCTGGCCGTGGACATTCGATATGCGCGAGCGCCTGAATGTGGTGGATTGCGGTGATCTGGTGTTTGCGTTCGGTGATGCACAGGACATGAGTGATAAGTTACAGGCGCACACAGAAAAAGTGCTGGCGTCCGGTAAAAAATGTCTCTCTTTCGGGGGCGATCACTTTGTGACGCTGCCGCTGCTGCGTGCACACGCCAAACATTTCGGTAAGATGGCGCTGGTGCATTTCGATGCCCATACCGACACTTACGGCAACGGCAGCAAGTTTGACCACGGCACTATGTTCTATCACGCCCCGAATGAGGGACTGATTGACCCGGCGCATTCCGTGCAGATTGGTATCCGTACCGAGCATGAAACAGATAACGGTTTCACCGTGATCGATGCGGCGCAGGTCAATGACCGCACCGTGGATGATGTGATTGCTCAGGTGAAAGCGATTGTCGGTGATATGCCGGTTTATCTGACCTTCGATATCGACTGTCTGGACCCGGCATTTGCCCCGGGCACCGGCACACCGGTTATCGGCGGGCTGACAACTGACCGCGCGCTGAAACTGCTGCGCGGCCTTCAGCCGCTCAATATCGTCGGCATGGATCTGGTGGAAGTGGCACCGGCGTATGATCAGTCCGATATTACGGCACTGGCCGGCGCAACCATCGCACTGGAAATGCTCTATCTCCAGGCCGCGAAGAAAGGCTGAAACCGGTTTCACCACCGTTAAAACAAAAGACCCGCAGTGCGGGTCTTTTT