Homologs in group_2538

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02450 FBDBKF_02450 100.0 Morganella morganii S1 ahcY adenosylhomocysteinase
EHELCC_02920 EHELCC_02920 100.0 Morganella morganii S2 ahcY adenosylhomocysteinase
NLDBIP_00540 NLDBIP_00540 100.0 Morganella morganii S4 ahcY adenosylhomocysteinase
HKOGLL_01535 HKOGLL_01535 100.0 Morganella morganii S5 ahcY adenosylhomocysteinase
F4V73_RS04825 F4V73_RS04825 91.3 Morganella psychrotolerans - adenosylhomocysteinase

Distribution of the homologs in the orthogroup group_2538

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2538

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q58783 2.19e-165 473 54 2 408 1 MJ1388 S-inosyl-L-homocysteine hydrolase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9UYK5 1.38e-163 469 54 2 409 3 ahcY Adenosylhomocysteinase Pyrococcus abyssi (strain GE5 / Orsay)
P50251 1.19e-162 466 55 2 409 1 ahcY Adenosylhomocysteinase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O58275 3.97e-160 460 54 2 410 3 ahcY Adenosylhomocysteinase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q6LYR8 1.55e-158 456 53 2 409 1 ahcY S-inosyl-L-homocysteine hydrolase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
O67240 2.36e-158 456 52 2 411 3 ahcY Adenosylhomocysteinase Aquifex aeolicus (strain VF5)
Q5JED2 3.26e-158 455 55 1 409 3 ahcY Adenosylhomocysteinase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O27673 5.35e-154 444 53 1 409 3 MTH_1636 S-inosyl-L-homocysteine hydrolase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P58855 4.37e-150 435 50 2 410 3 MK0368 S-inosyl-L-homocysteine hydrolase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8PUQ4 4.43e-150 434 51 2 404 3 MM_2278 S-inosyl-L-homocysteine hydrolase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O28279 2.45e-147 427 51 2 401 3 ahcY Adenosylhomocysteinase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q975T0 1.85e-146 425 50 2 408 3 ahcY Adenosylhomocysteinase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8TRA5 2.19e-145 422 50 2 404 3 ahcY2 S-inosyl-L-homocysteine hydrolase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O51933 2.63e-144 419 50 1 401 1 ahcY Adenosylhomocysteinase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q4JAZ7 6.31e-144 419 48 2 409 1 ahcY Adenosylhomocysteinase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q8DGC8 2.75e-142 415 51 2 409 3 ahcY Adenosylhomocysteinase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8ZTQ7 2.43e-140 410 47 3 435 3 ahcY Adenosylhomocysteinase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P50252 2.47e-140 410 50 5 414 3 ahcY Adenosylhomocysteinase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
B7K8X6 3.5e-140 410 50 2 409 3 ahcY Adenosylhomocysteinase Gloeothece citriformis (strain PCC 7424)
Q7NGI6 3.28e-138 405 49 2 410 3 ahcY Adenosylhomocysteinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P74008 3.42e-138 404 50 2 409 1 ahcY Adenosylhomocysteinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9HKX4 3.12e-135 396 48 3 403 3 ahcY Adenosylhomocysteinase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8YX05 1.01e-134 395 49 2 409 3 ahcY Adenosylhomocysteinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9YEF2 7.54e-134 393 48 1 409 3 ahcY Adenosylhomocysteinase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q979Z4 3.6e-131 386 47 2 403 3 ahcY Adenosylhomocysteinase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
G0LFB0 4.6e-129 382 47 3 408 3 ahcY Adenosylhomocysteinase Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23)
Q18EV6 1.06e-128 380 47 3 408 3 ahcY Adenosylhomocysteinase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q9HN50 5.55e-119 355 46 3 404 3 ahcY Adenosylhomocysteinase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7F2 5.55e-119 355 46 3 404 3 ahcY Adenosylhomocysteinase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q6MNC0 3.21e-100 309 41 5 411 3 ahcY Adenosylhomocysteinase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P10819 3.43e-98 303 40 3 410 1 sahA Adenosylhomocysteinase Dictyostelium discoideum
O13639 4.47e-97 300 40 3 418 3 pi047 Adenosylhomocysteinase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P51893 1.1e-96 299 39 2 408 2 ahcy-a Adenosylhomocysteinase A Xenopus laevis
O93477 2.52e-96 298 38 2 408 2 ahcy-b Adenosylhomocysteinase B Xenopus laevis
A1WXM7 4.3e-96 297 40 5 418 3 ahcY Adenosylhomocysteinase Halorhodospira halophila (strain DSM 244 / SL1)
P27604 1.58e-95 296 39 3 411 3 ahcy-1 Adenosylhomocysteinase Caenorhabditis elegans
Q710C4 3.88e-95 295 40 2 407 3 AHCY Adenosylhomocysteinase Sus scrofa
Q4R596 8.34e-95 294 39 2 407 2 AHCY Adenosylhomocysteinase Macaca fascicularis
P50247 8.43e-95 294 40 2 407 1 Ahcy Adenosylhomocysteinase Mus musculus
P23526 1.14e-94 293 39 2 407 1 AHCY Adenosylhomocysteinase Homo sapiens
Q27580 2e-94 293 39 3 408 1 Ahcy Adenosylhomocysteinase Drosophila melanogaster
Q3MHL4 2.4e-94 293 40 2 407 2 AHCY Adenosylhomocysteinase Bos taurus
O76757 2.12e-93 290 39 4 418 2 Ahcy13 Adenosylhomocysteinase Anopheles gambiae
Q8EXV1 5.04e-93 290 40 3 408 3 ahcY Adenosylhomocysteinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FU8 5.04e-93 290 40 3 408 3 ahcY Adenosylhomocysteinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q04WX0 5.61e-93 289 40 3 409 3 ahcY Adenosylhomocysteinase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NN6 5.61e-93 289 40 3 409 3 ahcY Adenosylhomocysteinase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
P10760 6.39e-93 289 39 2 407 1 Ahcy Adenosylhomocysteinase Rattus norvegicus
B6J6H1 4.01e-92 287 39 3 408 3 ahcY Adenosylhomocysteinase Coxiella burnetii (strain CbuK_Q154)
A4SF77 5.53e-92 288 37 4 443 3 ahcY Adenosylhomocysteinase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A9KD88 6.73e-92 286 39 3 408 3 ahcY Adenosylhomocysteinase Coxiella burnetii (strain Dugway 5J108-111)
P83783 6.99e-92 287 38 2 423 1 SAH1 Adenosylhomocysteinase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q83A77 2.04e-91 285 39 3 408 3 ahcY Adenosylhomocysteinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J3R0 2.04e-91 285 39 3 408 3 ahcY Adenosylhomocysteinase Coxiella burnetii (strain CbuG_Q212)
Q8KEG8 8.41e-91 285 38 5 443 3 ahcY Adenosylhomocysteinase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A0M5W6 2.66e-90 283 40 5 411 3 ahcY Adenosylhomocysteinase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B3EDY3 7.55e-90 282 37 4 443 3 ahcY Adenosylhomocysteinase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A5FJK3 1.2e-89 281 39 5 411 3 ahcY Adenosylhomocysteinase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
P39954 1.51e-89 281 38 2 423 1 SAH1 Adenosylhomocysteinase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q3B532 1.69e-89 281 37 4 443 3 ahcY Adenosylhomocysteinase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q30WL8 2.26e-89 281 38 5 446 3 ahcY Adenosylhomocysteinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P36889 1.72e-88 278 38 2 417 3 None Adenosylhomocysteinase Leishmania donovani
Q3A392 5.84e-88 278 38 7 450 3 ahcY Adenosylhomocysteinase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7TTZ5 3.13e-87 275 38 6 420 3 ahcY Adenosylhomocysteinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8A407 4.98e-87 275 37 6 444 3 ahcY Adenosylhomocysteinase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q82WL1 7.04e-87 275 38 6 446 3 ahcY Adenosylhomocysteinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B3QMF5 1.06e-86 274 37 6 443 3 ahcY Adenosylhomocysteinase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q01VU1 1.37e-86 274 36 4 444 3 ahcY Adenosylhomocysteinase Solibacter usitatus (strain Ellin6076)
Q3AQC2 1.43e-86 274 37 5 444 3 ahcY Adenosylhomocysteinase Chlorobium chlorochromatii (strain CaD3)
Q0BW40 4.26e-86 272 38 4 416 3 ahcY Adenosylhomocysteinase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q0AEV8 5.71e-86 273 37 5 446 3 ahcY Adenosylhomocysteinase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A6GW32 7.26e-86 271 38 5 411 3 ahcY Adenosylhomocysteinase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q60CG8 1.89e-85 271 37 5 443 3 ahcY Adenosylhomocysteinase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q64MT2 2e-85 271 37 6 446 3 ahcY Adenosylhomocysteinase Bacteroides fragilis (strain YCH46)
B4SD43 5.1e-85 270 37 5 443 3 ahcY Adenosylhomocysteinase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A9C184 1.97e-84 268 36 4 448 3 ahcY Adenosylhomocysteinase Delftia acidovorans (strain DSM 14801 / SPH-1)
P61617 6.03e-84 267 36 4 443 3 ahcY Adenosylhomocysteinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2JIP4 1.09e-83 266 36 5 446 3 ahcY Adenosylhomocysteinase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0C427 1.93e-83 266 37 5 444 3 ahcY Adenosylhomocysteinase Hyphomonas neptunium (strain ATCC 15444)
Q13AQ5 2.76e-83 265 35 5 451 3 ahcY Adenosylhomocysteinase Rhodopseudomonas palustris (strain BisB5)
B1VUW6 4.84e-83 265 36 6 457 3 ahcY Adenosylhomocysteinase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q8FRJ4 7.22e-83 265 35 6 453 3 ahcY Adenosylhomocysteinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1BEZ2 8.87e-83 264 37 5 443 3 ahcY Adenosylhomocysteinase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2IZR1 9.46e-83 264 35 5 451 3 ahcY Adenosylhomocysteinase Rhodopseudomonas palustris (strain HaA2)
A4QC87 1.34e-82 264 36 7 453 3 ahcY Adenosylhomocysteinase Corynebacterium glutamicum (strain R)
Q8Y387 1.42e-82 264 35 4 447 3 ahcY Adenosylhomocysteinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8NSC4 1.49e-82 264 36 7 453 3 ahcY Adenosylhomocysteinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q7NZF7 2.6e-82 263 36 6 444 3 ahcY Adenosylhomocysteinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5NR48 3.08e-82 263 35 6 445 3 ahcY Adenosylhomocysteinase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q12663 3.12e-82 262 38 7 425 2 SAHH Adenosylhomocysteinase (Fragment) Pneumocystis carinii
Q0KF25 3.71e-82 263 35 5 446 3 ahcY Adenosylhomocysteinase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3QJT3 4.06e-82 262 35 5 449 3 ahcY Adenosylhomocysteinase Rhodopseudomonas palustris (strain TIE-1)
Q476T8 4.41e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LS20 5.18e-82 262 35 5 449 3 ahcY Adenosylhomocysteinase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2STU0 5.26e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PT2 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia pseudomallei (strain K96243)
A3NER1 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia pseudomallei (strain 668)
Q3JY79 5.49e-82 262 35 5 446 1 ahcY Adenosylhomocysteinase Burkholderia pseudomallei (strain 1710b)
A3P0L8 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia pseudomallei (strain 1106a)
A1V8Z2 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia mallei (strain SAVP1)
Q62G22 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia mallei (strain ATCC 23344)
A2S6W2 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia mallei (strain NCTC 10229)
A3MQW7 5.49e-82 262 35 5 446 3 ahcY Adenosylhomocysteinase Burkholderia mallei (strain NCTC 10247)
Q6N2N5 6.44e-82 262 35 5 449 3 ahcY Adenosylhomocysteinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B2U774 6.56e-82 262 35 4 447 3 ahcY Adenosylhomocysteinase Ralstonia pickettii (strain 12J)
Q1CY84 1.12e-81 261 35 7 448 3 ahcY Adenosylhomocysteinase Myxococcus xanthus (strain DK1622)
B2AGG2 1.27e-81 261 35 5 446 3 ahcY Adenosylhomocysteinase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q9KZM1 1.31e-81 261 36 6 457 3 ahcY Adenosylhomocysteinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q1BCD6 2.8e-81 261 35 6 454 3 ahcY Adenosylhomocysteinase Mycobacterium sp. (strain MCS)
A1UCK8 2.8e-81 261 35 6 454 3 ahcY Adenosylhomocysteinase Mycobacterium sp. (strain KMS)
A9BD69 4.32e-81 260 35 4 444 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9211)
Q8GGL7 5.98e-81 259 36 6 439 3 ahcY Adenosylhomocysteinase Streptomyces atroolivaceus
Q82DC9 7.41e-81 259 35 7 457 3 ahcY Adenosylhomocysteinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7V9P3 8.3e-81 259 35 5 447 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A6T2Y9 9.09e-81 259 35 4 448 3 ahcY Adenosylhomocysteinase Janthinobacterium sp. (strain Marseille)
A3PW97 9.27e-81 259 35 6 454 3 ahcY Adenosylhomocysteinase Mycobacterium sp. (strain JLS)
A1W3P0 1.95e-80 258 36 5 448 3 ahcY Adenosylhomocysteinase Acidovorax sp. (strain JS42)
P61456 2e-80 258 36 8 456 3 ahcY Adenosylhomocysteinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q87EI8 2.17e-80 258 35 6 449 3 ahcY Adenosylhomocysteinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I7N4 2.17e-80 258 35 6 449 3 ahcY Adenosylhomocysteinase Xylella fastidiosa (strain M23)
A4G975 2.68e-80 258 35 4 448 3 ahcY Adenosylhomocysteinase Herminiimonas arsenicoxydans
B1Y647 2.77e-80 258 35 5 449 3 ahcY Adenosylhomocysteinase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B0U232 2.87e-80 258 35 6 449 3 ahcY Adenosylhomocysteinase Xylella fastidiosa (strain M12)
B9MD45 3.88e-80 258 35 5 448 3 ahcY Adenosylhomocysteinase Acidovorax ebreus (strain TPSY)
Q13T36 5.26e-80 257 36 6 447 3 ahcY Adenosylhomocysteinase Paraburkholderia xenovorans (strain LB400)
B2T6X2 5.26e-80 257 36 6 447 3 ahcY Adenosylhomocysteinase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q7VUL8 6.62e-80 257 35 4 447 3 ahcY Adenosylhomocysteinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7RKK8 7.1e-80 257 34 7 460 3 PY02893 Adenosylhomocysteinase Plasmodium yoelii yoelii
Q7UZN3 7.78e-80 256 35 4 446 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q9PEJ1 8.74e-80 257 35 6 449 3 ahcY Adenosylhomocysteinase Xylella fastidiosa (strain 9a5c)
Q4XZZ5 2.28e-79 256 35 7 460 3 PC000295.02.0 Adenosylhomocysteinase Plasmodium chabaudi chabaudi
A6WX40 3.48e-79 254 36 6 446 3 ahcY Adenosylhomocysteinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5ENA7 4.52e-79 254 34 4 450 3 ahcY Adenosylhomocysteinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
C5CM29 4.61e-79 255 35 4 448 3 ahcY Adenosylhomocysteinase Variovorax paradoxus (strain S110)
A2SL00 4.92e-79 254 36 6 449 3 ahcY Adenosylhomocysteinase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q318B6 5.63e-79 254 35 5 443 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9312)
P50250 5.96e-79 254 34 7 459 1 PFE1050w Adenosylhomocysteinase Plasmodium falciparum (isolate 3D7)
B0UM37 6e-79 254 35 4 448 3 ahcY Adenosylhomocysteinase Methylobacterium sp. (strain 4-46)
A0A087WNH6 7.16e-79 254 35 5 450 1 ahcY Adenosylhomocysteinase Bradyrhizobium elkanii
Q98CM3 8.64e-79 254 35 5 446 3 ahcY Adenosylhomocysteinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B8IPU4 9.31e-79 254 35 4 448 3 ahcY Adenosylhomocysteinase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A9IGY5 1.01e-78 254 35 4 445 3 ahcY Adenosylhomocysteinase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4ZHR8 1.24e-78 254 35 6 453 1 ahcY Adenosylhomocysteinase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2G6T1 1.93e-78 253 35 5 444 3 ahcY Adenosylhomocysteinase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q8FXZ7 2.66e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella suis biovar 1 (strain 1330)
B0CJJ7 2.66e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M9T1 2.66e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AG3 2.66e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella abortus biovar 1 (strain 9-941)
Q2YQX8 2.66e-78 252 36 6 446 1 ahcY Adenosylhomocysteinase Brucella abortus (strain 2308)
B2S994 2.66e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella abortus (strain S19)
Q8YE49 2.89e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFY3 2.89e-78 252 36 6 446 3 ahcY Adenosylhomocysteinase Brucella melitensis biotype 2 (strain ATCC 23457)
A1VFZ7 3.13e-78 253 37 5 445 3 ahcY Adenosylhomocysteinase Nitratidesulfovibrio vulgaris (strain DP4)
Q72EH1 3.13e-78 253 37 5 445 3 ahcY Adenosylhomocysteinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q89HP6 3.49e-78 252 34 4 450 3 ahcY Adenosylhomocysteinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A3PFB5 3.62e-78 252 35 5 446 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9301)
Q5YQS7 4.16e-78 253 35 7 454 3 ahcY Adenosylhomocysteinase Nocardia farcinica (strain IFM 10152)
A5VT52 4.16e-78 252 35 6 446 3 ahcY Adenosylhomocysteinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P51540 5.95e-78 252 35 7 456 3 None Adenosylhomocysteinase Trichomonas vaginalis
Q8PP84 1.13e-77 251 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas axonopodis pv. citri (strain 306)
Q1GWT5 1.17e-77 251 35 6 450 3 ahcY Adenosylhomocysteinase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q3BXC6 1.43e-77 251 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A9VYP7 2.79e-77 250 34 5 449 3 ahcY Adenosylhomocysteinase Methylorubrum extorquens (strain PA1)
B7KSJ4 2.79e-77 250 34 5 449 3 ahcY Adenosylhomocysteinase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q7W1Z7 2.88e-77 250 35 4 447 3 ahcY Adenosylhomocysteinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQX5 2.88e-77 250 35 4 447 3 ahcY Adenosylhomocysteinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
O50562 4.6e-77 249 36 6 450 3 ahcY Adenosylhomocysteinase Cereibacter sphaeroides
Q0ALW1 4.69e-77 249 36 6 446 3 ahcY Adenosylhomocysteinase Maricaulis maris (strain MCS10)
A8G7D1 4.86e-77 249 34 4 446 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9215)
Q11CD0 5.11e-77 249 35 7 446 3 ahcY Adenosylhomocysteinase Chelativorans sp. (strain BNC1)
Q5P6B7 5.65e-77 249 34 4 446 3 ahcY Adenosylhomocysteinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8PCH5 7.19e-77 249 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQZ8 7.19e-77 249 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas campestris pv. campestris (strain 8004)
B2SPN6 7.75e-77 249 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZE3 7.75e-77 249 35 5 449 3 ahcY Adenosylhomocysteinase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q01781 8.1e-77 249 34 5 455 2 SAHH Adenosylhomocysteinase Petroselinum crispum
A1TUG3 8.88e-77 249 35 4 448 3 ahcY Adenosylhomocysteinase Paracidovorax citrulli (strain AAC00-1)
Q3ANF4 9.82e-77 249 34 5 450 3 ahcY Adenosylhomocysteinase Synechococcus sp. (strain CC9605)
P9WGV3 9.93e-77 249 35 7 456 1 ahcY Adenosylhomocysteinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGV2 9.93e-77 249 35 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U7S2 9.93e-77 249 35 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AH22 9.93e-77 249 35 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KNQ0 9.93e-77 249 35 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TWW7 1.49e-76 249 35 7 456 1 ahcY Adenosylhomocysteinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0PRF5 1.52e-76 249 34 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium ulcerans (strain Agy99)
Q0IDX7 1.57e-76 248 34 5 448 3 ahcY Adenosylhomocysteinase Synechococcus sp. (strain CC9311)
B1ZLX0 1.72e-76 248 34 5 449 3 ahcY Adenosylhomocysteinase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q3B0K7 2.17e-76 248 34 5 448 3 ahcY Adenosylhomocysteinase Synechococcus sp. (strain CC9902)
B2HEP6 2.51e-76 248 34 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium marinum (strain ATCC BAA-535 / M)
B1XSH8 3.33e-76 247 34 4 448 3 ahcY Adenosylhomocysteinase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9ZNA5 3.68e-76 247 35 5 444 3 ahcY Adenosylhomocysteinase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q9SP37 3.69e-76 247 35 6 455 1 SAHH Adenosylhomocysteinase Lupinus luteus
Q7V926 4.62e-76 247 34 4 447 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9313)
A2C620 5.14e-76 247 34 4 447 3 ahcY Adenosylhomocysteinase Prochlorococcus marinus (strain MIT 9303)
C6C1F4 5.44e-76 246 36 5 445 3 ahcY Adenosylhomocysteinase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P68173 6.35e-76 247 35 5 455 2 SAHH Adenosylhomocysteinase Nicotiana tabacum
P68172 6.35e-76 247 35 5 455 2 SAHH Adenosylhomocysteinase Nicotiana sylvestris
P35007 6.42e-76 247 35 5 455 2 SAHH Adenosylhomocysteinase Catharanthus roseus
B8DR41 1.88e-75 245 36 5 445 3 ahcY Adenosylhomocysteinase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
P32112 2.01e-75 246 35 7 456 2 SAHH Adenosylhomocysteinase Triticum aestivum
Q9CCJ4 2.03e-75 246 34 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium leprae (strain TN)
B8ZQE9 2.03e-75 246 34 7 456 3 ahcY Adenosylhomocysteinase Mycobacterium leprae (strain Br4923)
Q7U9Y3 2.52e-75 245 33 5 451 3 ahcY Adenosylhomocysteinase Parasynechococcus marenigrum (strain WH8102)
P93253 4.2e-75 244 34 5 455 2 SAHH Adenosylhomocysteinase Mesembryanthemum crystallinum
P50249 5.25e-75 244 35 5 455 2 SAHH Adenosylhomocysteinase Phalaenopsis sp.
P28183 1.02e-74 243 34 5 450 3 ahcY Adenosylhomocysteinase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O23255 1.14e-74 243 34 6 455 1 SAHH1 Adenosylhomocysteinase 1 Arabidopsis thaliana
A6UEJ1 1.14e-74 243 34 5 446 3 ahcY Adenosylhomocysteinase Sinorhizobium medicae (strain WSM419)
Q92TC1 1.27e-74 243 34 5 446 3 ahcY Adenosylhomocysteinase Rhizobium meliloti (strain 1021)
Q6G584 1.35e-74 243 34 6 446 3 ahcY Adenosylhomocysteinase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q936D6 1.46e-74 243 35 8 457 3 ahcY Adenosylhomocysteinase Streptomyces argillaceus
Q6G1D6 1.59e-74 243 34 5 446 3 ahcY Adenosylhomocysteinase Bartonella quintana (strain Toulouse)
A4T0E9 1.98e-74 243 34 4 448 3 ahcY Adenosylhomocysteinase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A5GI30 5.81e-74 241 33 4 447 3 ahcY Adenosylhomocysteinase Synechococcus sp. (strain WH7803)
A9IL83 5.89e-74 241 34 6 446 3 ahcY Adenosylhomocysteinase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q9ABH0 1.12e-73 240 35 6 451 3 ahcY Adenosylhomocysteinase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9LK36 1.51e-73 241 34 6 455 2 SAHH2 Adenosylhomocysteinase 2 Arabidopsis thaliana
Q5R889 2.23e-73 241 34 3 409 2 AHCYL2 Putative adenosylhomocysteinase 3 Pongo abelii
B9JG53 3.55e-73 239 34 6 446 3 ahcY Adenosylhomocysteinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2KE72 3.63e-73 239 34 6 446 3 ahcY Adenosylhomocysteinase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MNC6 4.12e-73 239 34 6 446 3 ahcY Adenosylhomocysteinase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q73UK6 7.6e-73 239 34 7 460 3 ahcY Adenosylhomocysteinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9SWF5 1.47e-72 238 34 5 454 2 SAHH Adenosylhomocysteinase Solanum lycopersicum
B3PVW2 1.48e-72 238 34 6 446 3 ahcY Adenosylhomocysteinase Rhizobium etli (strain CIAT 652)
B5ZV80 2.4e-72 237 34 6 446 3 ahcY Adenosylhomocysteinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q68FL4 7.06e-72 239 34 3 409 1 Ahcyl2 Putative adenosylhomocysteinase 3 Mus musculus
A6QLP2 7.36e-72 239 34 3 409 1 AHCYL2 Adenosylhomocysteinase 3 Bos taurus
Q96HN2 8.09e-72 239 34 3 409 1 AHCYL2 Adenosylhomocysteinase 3 Homo sapiens
Q8UJ99 1.21e-71 235 34 5 446 3 ahcY Adenosylhomocysteinase Agrobacterium fabrum (strain C58 / ATCC 33970)
P50246 1.41e-71 236 34 6 455 2 SAHH Adenosylhomocysteinase Medicago sativa
Q2SLT4 6.28e-70 231 35 7 438 3 ahcY Adenosylhomocysteinase Hahella chejuensis (strain KCTC 2396)
Q9VZX9 6.46e-69 229 34 3 401 1 AhcyL1 Adenosylhomocysteinase-like 1 Drosophila melanogaster
Q9I685 2.83e-68 226 34 7 438 1 ahcY Adenosylhomocysteinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V419 2.83e-68 226 34 7 438 1 ahcY Adenosylhomocysteinase Pseudomonas aeruginosa (strain LESB58)
Q02TY0 3.42e-68 226 34 7 438 3 ahcY Adenosylhomocysteinase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6FA43 2.2e-67 224 35 6 432 3 ahcY Adenosylhomocysteinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P50245 3.87e-67 224 34 3 408 2 AhcyL2 Adenosylhomocysteinase-like 2 Drosophila melanogaster
A4VRF7 6.46e-67 223 34 6 442 3 ahcY Adenosylhomocysteinase Stutzerimonas stutzeri (strain A1501)
B5DFN2 8.02e-67 223 33 3 409 1 Ahcyl1 S-adenosylhomocysteine hydrolase-like protein 1 Rattus norvegicus
Q80SW1 5.09e-66 222 33 3 409 1 Ahcyl1 S-adenosylhomocysteine hydrolase-like protein 1 Mus musculus
O43865 5.09e-66 222 33 3 409 1 AHCYL1 S-adenosylhomocysteine hydrolase-like protein 1 Homo sapiens
B0KM00 1.72e-65 219 34 7 438 3 ahcY Adenosylhomocysteinase Pseudomonas putida (strain GB-1)
Q1I3W5 1.72e-65 219 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas entomophila (strain L48)
A4XPF3 4.23e-65 218 34 7 438 3 ahcY Adenosylhomocysteinase Pseudomonas mendocina (strain ymp)
Q3K5D7 7.5e-65 218 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas fluorescens (strain Pf0-1)
B1J2Y8 9.07e-65 217 34 7 442 3 ahcY Adenosylhomocysteinase Pseudomonas putida (strain W619)
Q4K4H7 9.77e-65 217 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5WA09 3.41e-64 216 33 7 438 3 ahcY Adenosylhomocysteinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4ZZ92 5.32e-64 215 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas syringae pv. syringae (strain B728a)
C3K3G6 1.01e-63 214 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas fluorescens (strain SBW25)
Q48PB5 1.53e-63 214 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87V73 2.72e-62 211 33 6 438 3 ahcY Adenosylhomocysteinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P26799 1.53e-08 55 31 1 96 3 ahcY Adenosylhomocysteinase (Fragment) Streptomyces fradiae
A8I679 0.000124 47 31 6 161 3 ilvC Ketol-acid reductoisomerase (NADP(+)) Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8UDV0 0.00024 46 30 3 127 3 ilvC Ketol-acid reductoisomerase (NADP(+)) Agrobacterium fabrum (strain C58 / ATCC 33970)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_01495
Feature type CDS
Gene ahcY
Product adenosylhomocysteinase
Location 284525 - 285772 (strand: 1)
Length 1248 (nucleotides) / 415 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2538
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00670 S-adenosyl-L-homocysteine hydrolase, NAD binding domain
PF05221 S-adenosyl-L-homocysteine hydrolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0499 Coenzyme transport and metabolism (H) H S-adenosylhomocysteine hydrolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01251 adenosylhomocysteinase [EC:3.13.2.1] Cysteine and methionine metabolism
Metabolic pathways
Methionine degradation

Protein Sequence

MVTSIYKDLSLAPQGEQKIAWVRAHMPLLRALEQRFTQEQPFAGKRIALSIHLEAKTAYLARVLAAGGAEVSVTGSNPMSTKDDIVAALVVSGIHTFAIHGADAEAYRNFVKQTLACEPHIVIDDGGDLVHELHSLYPEYAKHTIGACEETTTGVLRAVAREKNGALNFPVLSINGAQSKHLFDNRYGTGQSTFDGIMRTTNLVIAGKTVVVAGYGWCGKGCAMRAKGLGAEVIVTEVDPIKALEAKMDGFAVMTMSAAAPLGDIFITATGCCDVLTSDHFSLMKEGAIISNTGHFEDEINLTDLQQLSDSVTIARENIEGYTLKNGRTLYLLGRGALVNIACADGHPAEIMDMSFALQALSAEYLLSHDHEAKVYDVSDEIDREVAALKLQDMGVSLDNLTTRQQQYLNGYELK

Flanking regions ( +/- flanking 50bp)

TCCGGTTACTGTGGCTCATCCCGTTATAAAAGCCGTATGCAGGAGTTGCCATGGTTACCAGTATTTATAAAGATCTCTCCTTAGCACCACAGGGTGAGCAAAAAATCGCCTGGGTTCGCGCCCATATGCCGCTGCTGCGTGCACTGGAACAGCGTTTCACACAAGAACAGCCGTTTGCCGGAAAACGCATAGCGCTTTCTATTCATCTGGAAGCAAAAACCGCCTATCTGGCACGGGTTCTGGCCGCAGGCGGGGCTGAGGTGTCCGTCACCGGCAGCAACCCGATGTCCACCAAAGACGATATCGTGGCCGCACTGGTTGTCAGCGGTATTCATACGTTTGCCATCCACGGCGCGGATGCGGAAGCCTACCGCAACTTTGTAAAACAGACTCTGGCCTGTGAACCGCACATTGTTATTGATGACGGCGGTGACCTGGTACATGAGCTGCACAGCCTGTATCCGGAATATGCAAAGCACACGATCGGTGCCTGTGAAGAGACCACCACCGGTGTTCTGCGTGCAGTGGCCCGTGAAAAAAACGGCGCACTGAATTTCCCGGTGCTGTCGATTAACGGTGCACAATCCAAACACCTGTTTGATAACCGTTACGGTACCGGACAATCCACTTTTGACGGCATTATGCGTACCACCAACCTGGTTATTGCCGGGAAAACCGTGGTCGTCGCCGGTTACGGCTGGTGCGGAAAAGGCTGTGCCATGCGGGCGAAAGGACTGGGCGCGGAAGTGATTGTCACAGAAGTGGATCCGATAAAAGCCCTGGAAGCGAAAATGGACGGCTTTGCGGTCATGACCATGTCCGCCGCAGCACCGCTGGGTGATATCTTTATCACCGCCACCGGTTGCTGTGATGTACTGACATCGGATCATTTCAGTCTGATGAAAGAGGGTGCCATTATCAGTAATACCGGGCACTTTGAGGATGAAATCAATCTGACCGATCTTCAGCAGTTAAGTGACAGTGTCACAATTGCCCGCGAAAACATCGAAGGTTATACCCTGAAAAATGGCCGCACACTCTATCTGCTGGGCCGTGGTGCGCTGGTTAATATTGCCTGTGCGGACGGGCATCCGGCAGAAATTATGGACATGAGCTTTGCTCTTCAGGCACTCAGCGCCGAGTATCTGCTCAGCCATGACCACGAAGCAAAAGTCTATGATGTCAGTGATGAAATCGACCGTGAAGTGGCGGCACTGAAATTACAGGATATGGGGGTTTCACTTGATAATCTGACCACCAGACAGCAGCAGTATCTGAACGGCTACGAGCTGAAGTAACCTGACTGACGGGCTGCCGGTAATCCGCAGCCCGTCAAAACCGGTGTTTA