Homologs in group_2237

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17135 FBDBKF_17135 100.0 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_01755 EHELCC_01755 100.0 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_01705 NLDBIP_01705 100.0 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
HKOGLL_00370 HKOGLL_00370 100.0 Morganella morganii S5 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS05895 F4V73_RS05895 95.5 Morganella psychrotolerans - response regulator transcription factor
PMI_RS08300 PMI_RS08300 78.3 Proteus mirabilis HI4320 - response regulator transcription factor

Distribution of the homologs in the orthogroup group_2237

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2237

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GP20 5.09e-110 317 69 0 219 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q9HV32 1.44e-54 177 43 0 214 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P66795 2e-53 174 43 0 216 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 2e-53 174 43 0 216 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q70FH0 8.14e-52 169 43 0 218 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q8XBS3 1.87e-51 169 41 0 216 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P52076 3.37e-51 168 41 0 216 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P45337 6.29e-47 157 38 0 216 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P36556 7.09e-45 152 38 0 221 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P30843 1.06e-44 151 39 0 221 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q9I0I1 1.3e-38 136 36 1 215 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55701 2.66e-36 130 33 2 221 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8X738 3.29e-36 130 33 1 221 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q83RR0 8.02e-36 129 33 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 8.02e-36 129 33 1 221 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 8.55e-36 129 33 1 221 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q8Z7H2 3.18e-35 127 33 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 4.03e-35 127 33 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 4.03e-35 127 33 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 4.03e-35 127 33 1 221 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 4.03e-35 127 33 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 4.03e-35 127 33 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC3 5e-35 127 33 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
A0R3I8 8.05e-35 126 33 3 225 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9I4F9 4.06e-34 124 35 1 222 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45607 4.65e-34 124 33 4 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
A1TEL7 8.82e-34 124 33 6 230 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1B3X8 1.53e-33 123 32 3 225 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.53e-33 123 32 3 225 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.53e-33 123 32 3 225 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q742C1 2.6e-33 122 32 3 225 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 2.6e-33 122 32 3 225 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q9CD68 4.83e-33 122 32 3 225 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P0A4I0 5.07e-33 121 33 1 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 5.07e-33 121 33 1 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P45605 5.58e-33 121 33 4 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P0AFJ5 1.03e-32 121 32 4 220 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.03e-32 121 32 4 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 1.04e-32 120 32 4 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
A1KHB7 1.36e-32 120 31 3 225 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.36e-32 120 31 3 225 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 2.06e-32 120 31 3 225 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 2.06e-32 120 31 3 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 2.06e-32 120 31 3 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A0PWB4 4.73e-32 119 31 3 227 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q02540 9.83e-32 118 31 2 226 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P0DMK7 1.69e-31 117 31 3 221 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 1.69e-31 117 31 3 221 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P0A4H8 4.73e-31 116 33 3 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 4.73e-31 116 33 3 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0CL17 9.27e-31 115 32 4 224 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 9.27e-31 115 32 4 224 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P0C001 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.92e-30 114 33 4 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.92e-30 114 33 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q55933 4.3e-30 114 30 4 228 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8H358 9.89e-30 113 33 1 226 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 9.89e-30 113 33 1 226 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q4L6C6 1.27e-29 112 34 4 219 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P76340 2.08e-29 112 32 6 221 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q9ZHD3 2.35e-29 112 32 6 231 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P0ACZ8 2.78e-29 112 31 4 223 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.78e-29 112 31 4 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.78e-29 112 31 4 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q7D9K0 4.1e-29 112 33 3 227 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 4.1e-29 112 33 3 227 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9KM23 4.91e-29 112 32 3 216 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9F868 1.42e-28 110 33 3 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q99U73 2.65e-28 109 34 5 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P9WGL9 2.65e-28 109 32 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 2.65e-28 109 32 3 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 2.65e-28 109 32 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P94413 2.98e-28 109 30 6 232 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P23620 4.08e-28 108 31 3 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q47456 8.17e-28 108 30 2 220 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q47744 1.51e-27 107 30 2 218 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q49XM7 4.46e-27 106 33 4 221 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P32040 5.8e-27 106 32 3 229 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7A1J1 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 7.95e-27 105 30 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 7.95e-27 105 30 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 7.95e-27 105 30 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 7.95e-27 105 30 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 7.95e-27 105 30 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P9WGM1 9.4e-27 105 32 2 211 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 9.4e-27 105 32 2 211 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 9.4e-27 105 32 2 211 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q50136 1.02e-26 105 32 2 211 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q52990 1.07e-26 105 33 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
O34903 1.35e-26 105 28 2 223 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
O06978 2.18e-26 104 32 4 224 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q01473 2.83e-26 109 33 1 225 3 rcaC Protein RcaC Microchaete diplosiphon
L7N689 3.31e-26 104 30 2 224 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P21866 4.32e-26 103 30 3 219 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P9WGN1 5.34e-26 103 30 3 220 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 5.34e-26 103 30 3 220 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P44895 2.94e-25 101 36 4 225 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H3GGB5 6.32e-25 100 33 4 228 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P54884 6.99e-25 99 35 3 182 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q8CQ17 7.23e-25 100 29 5 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 7.23e-25 100 29 5 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q44006 1.09e-24 100 28 3 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8CQK0 1.22e-24 100 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.22e-24 100 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 1.34e-24 100 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P45189 1.74e-24 99 29 3 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P39663 1.78e-24 100 31 4 235 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9AE24 2.15e-24 99 28 4 225 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
A6WZ81 2.36e-24 99 31 3 227 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5HLN2 3.55e-24 98 28 2 218 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8FZ93 4.31e-24 98 31 3 227 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 4.31e-24 98 31 3 227 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 4.31e-24 98 31 3 227 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 4.31e-24 98 31 3 227 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 4.31e-24 98 31 3 227 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 4.31e-24 98 31 3 227 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 4.31e-24 98 31 3 227 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 4.31e-24 98 31 3 227 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
A6QJK3 5.53e-24 98 28 2 218 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 5.53e-24 98 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P0AE90 6.1e-24 98 33 5 229 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 6.1e-24 98 33 5 229 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 6.1e-24 98 33 5 229 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q2FWH6 7.61e-24 98 29 3 221 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2YZ24 8.61e-24 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A216 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.01e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.01e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.01e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.01e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CN92 1.19e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7A039 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q6GE73 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q7A3X1 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 1.43e-23 97 28 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0A4I2 1.87e-23 96 31 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.87e-23 96 31 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P37478 2.09e-23 97 30 3 228 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q4L8L9 3.25e-23 96 28 2 218 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q4A160 9.8e-23 95 29 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q31S42 1.27e-22 95 28 3 232 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5HPC3 1.94e-22 94 32 4 219 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P28835 1.97e-22 94 28 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
O69730 2.92e-22 94 29 3 224 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8CP82 3.36e-22 93 32 4 219 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P13792 3.69e-22 94 30 4 232 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
A0A4P7TS68 5.68e-22 93 32 5 233 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 5.68e-22 93 32 5 233 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 5.68e-22 93 32 5 233 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 5.68e-22 93 32 5 233 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 5.68e-22 93 32 5 233 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 5.68e-22 93 32 5 233 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 5.68e-22 93 32 5 233 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 5.68e-22 93 32 5 233 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q55890 7.36e-22 93 28 3 232 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P08368 7.6e-22 92 29 4 226 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
O78428 7.97e-22 93 28 5 231 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q49ZT8 1.43e-21 92 27 2 215 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P31079 1.65e-21 92 29 5 233 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q06239 1.85e-21 91 31 5 229 3 vanR Regulatory protein VanR Enterococcus faecium
Q9TLQ4 1.89e-21 92 29 4 235 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P94504 2.88e-21 91 27 4 230 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P9WGM7 3.4e-21 90 33 5 222 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 3.4e-21 90 33 5 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 3.4e-21 90 33 5 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 3.59e-21 90 33 5 222 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P35163 3.88e-21 91 27 3 234 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q8DPL7 4.26e-21 90 27 3 233 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 4.26e-21 90 27 3 233 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 4.26e-21 90 27 3 233 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9CCJ2 4.62e-21 90 33 5 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q82EB1 5.76e-21 90 28 2 230 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
G3XCY6 8.9e-21 90 32 7 227 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZEP4 1.08e-20 89 28 2 230 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q04942 1.73e-20 89 35 2 219 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O31432 2.71e-20 88 30 7 220 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P48259 2.73e-20 89 29 7 236 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P28257 2.96e-20 89 28 6 234 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
A0QTK2 3.73e-20 88 32 3 219 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P51358 3.63e-19 85 26 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 3.63e-19 85 26 4 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P42244 4.61e-19 85 29 3 224 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q7A0U4 7.61e-19 85 26 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 7.61e-19 85 26 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 7.61e-19 85 26 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 7.61e-19 85 26 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 7.61e-19 85 26 3 227 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 7.61e-19 85 26 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 7.61e-19 85 26 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 7.61e-19 85 26 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P58357 1.05e-18 84 29 5 228 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q9K621 2.8e-18 83 26 3 226 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P38684 3.02e-18 83 29 5 228 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P69228 3.06e-18 83 29 5 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 3.06e-18 83 29 5 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6GJ11 3.55e-18 82 28 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q8CQ37 4.41e-18 82 27 4 224 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 4.41e-18 82 27 4 224 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49VK3 5.2e-18 82 27 4 225 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O25918 6.54e-18 82 27 5 218 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q4L481 7.56e-18 82 28 5 226 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q8DN02 9.25e-18 81 26 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 9.25e-18 81 26 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2YSS2 2.02e-17 80 27 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z181 2.56e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 2.56e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 2.56e-17 80 26 4 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 2.56e-17 80 26 4 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 2.56e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q7A1L2 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 2.59e-17 80 26 4 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q932F1 4.3e-17 80 26 4 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
O32192 4.42e-17 80 29 3 217 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q07597 1.34e-16 78 26 3 223 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q44929 3.01e-16 78 28 4 226 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
Q9HUI2 1.06e-15 76 30 7 237 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O34951 5.79e-15 74 25 4 228 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P42421 1.39e-14 73 26 3 228 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q07783 5.34e-14 72 27 5 235 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P33112 5.64e-14 71 28 3 176 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
O24973 7.7e-14 71 29 3 224 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q04803 2.91e-13 70 30 4 222 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P50350 4.13e-13 69 23 3 238 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P54443 1.19e-12 68 28 5 208 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P50351 3.69e-12 67 23 3 239 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FUS8 7.91e-11 62 28 5 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 7.91e-11 62 28 5 155 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 7.91e-11 62 28 5 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 7.91e-11 62 28 5 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
P52108 1.03e-10 62 26 6 235 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
P24086 1.94e-10 60 30 1 120 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 1.94e-10 60 30 1 120 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9APD9 2.64e-10 62 35 2 111 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P44918 2.69e-10 61 22 4 233 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9Q4 6.42e-10 60 24 5 234 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 6.42e-10 60 24 5 234 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 6.42e-10 60 24 5 234 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 6.42e-10 60 24 5 234 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
O05251 8.61e-10 60 29 2 127 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
A5VW00 1.07e-09 59 27 5 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q00934 1.26e-09 60 35 1 101 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06065 1.82e-09 60 31 0 107 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P13359 2.74e-09 58 23 6 230 3 virG Regulatory protein VirG Rhizobium rhizogenes
P30198 9.09e-09 57 30 3 153 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
P14375 2.34e-08 57 33 2 111 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q88RJ6 2.38e-08 57 32 0 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P25852 2.57e-08 57 34 2 111 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I4N3 2.65e-08 57 28 2 159 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04848 2.74e-08 57 30 0 110 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8Z333 2.83e-08 56 34 2 111 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P09432 3.43e-08 56 27 0 110 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q88AQ2 4.5e-08 56 31 0 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P10046 4.54e-08 56 28 0 118 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P40138 5.16e-08 55 24 3 158 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q8X613 8.68e-08 55 32 2 111 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P0AFB8 9.16e-08 55 28 2 133 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 9.16e-08 55 28 2 133 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P10577 9.99e-08 55 28 0 107 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P28787 1.08e-07 55 28 1 123 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q3LWR6 1.25e-07 53 27 3 154 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.25e-07 53 27 3 154 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.25e-07 53 27 3 154 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0C5S5 1.28e-07 54 28 2 163 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.28e-07 54 28 2 163 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P23747 1.28e-07 54 31 0 107 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDE4 1.34e-07 53 28 1 111 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P10576 1.34e-07 54 28 0 111 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q87MX7 1.54e-07 54 28 2 163 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KT84 2.28e-07 53 40 0 70 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P62722 3.14e-07 53 25 6 230 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q8FW53 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.8e-07 50 29 4 117 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 3.8e-07 50 29 4 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q6K9T0 4.26e-07 50 29 4 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 4.26e-07 50 29 4 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q9HU19 5.45e-07 52 32 2 115 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P03029 6.6e-07 52 28 1 121 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P24072 6.89e-07 50 32 0 71 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q54YZ9 7.33e-07 52 35 3 117 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q54SK5 7.54e-07 52 33 2 120 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
B8GZM2 8.7e-07 52 33 1 74 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 8.7e-07 52 33 1 74 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7MM78 1.05e-06 52 42 0 70 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1.05e-06 52 42 0 70 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q5SML4 1.07e-06 52 29 5 139 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 1.07e-06 52 29 5 139 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q05943 1.2e-06 51 25 4 154 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9WY30 1.23e-06 51 29 2 107 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P41789 1.44e-06 51 27 2 133 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0PVB3 1.48e-06 50 29 5 119 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
Q4GZK4 1.81e-06 50 34 2 76 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q2HWG1 1.9e-06 48 28 2 110 2 RR12 Two-component response regulator ORR12 Oryza sativa subsp. japonica
P13632 1.98e-06 51 27 0 112 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q10WZ6 2.19e-06 50 31 1 72 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P07545 2.61e-06 50 25 8 235 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P52931 2.71e-06 50 30 2 101 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q9P4U6 2.76e-06 51 33 1 84 1 tcsB Two-component system protein B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P15940 2.83e-06 50 30 2 119 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8H7S7 3.04e-06 50 30 2 120 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 3.04e-06 50 30 2 120 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q2HWH1 3.66e-06 48 29 5 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 3.66e-06 48 29 5 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q6H468 4.78e-06 48 29 5 116 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 4.78e-06 48 29 5 116 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q54RP6 4.87e-06 50 28 3 139 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
P48359 5.22e-06 48 26 1 120 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P9WGM3 6.06e-06 48 30 3 118 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 6.06e-06 48 30 3 118 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9KM66 7.05e-06 49 31 1 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q44444 7.12e-06 49 25 6 230 3 virG Regulatory protein VirG Rhizobium radiobacter
Q8GVV6 1.28e-05 46 28 3 106 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. japonica
Q4GZK3 1.28e-05 46 28 3 106 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. indica
Q6YVX7 1.38e-05 48 31 1 66 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. japonica
Q4GZK9 1.38e-05 48 31 1 66 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. indica
Q56312 1.4e-05 46 25 0 83 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7WZY4 1.48e-05 47 22 6 204 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q9KSB1 1.58e-05 48 29 2 112 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43501 1.65e-05 46 28 1 116 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AEC5 1.71e-05 48 32 4 108 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.71e-05 48 32 4 108 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.71e-05 48 32 4 108 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q8D5Z6 1.74e-05 48 32 3 112 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P0A4H5 1.78e-05 46 30 0 70 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.78e-05 46 30 0 70 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7MD16 1.82e-05 48 32 3 112 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q9HV27 1.86e-05 48 34 1 79 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9P7Q7 1.99e-05 48 33 5 115 3 mak1 Peroxide stress-activated histidine kinase mak1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5A4X5 2.03e-05 48 32 5 105 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8D0P1 2.09e-05 46 25 2 120 3 cheY Chemotaxis protein CheY Yersinia pestis
Q6H805 2.13e-05 48 32 2 120 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
P0C5S3 2.25e-05 47 25 0 109 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
A2X1N2 2.29e-05 48 32 2 120 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
O07528 2.38e-05 47 22 8 204 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P39486 2.58e-05 47 27 3 133 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q4GZL0 2.65e-05 47 30 1 65 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q5A599 2.65e-05 48 30 3 118 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q2HWG4 2.78e-05 47 30 1 65 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
P0DMC6 2.96e-05 48 28 0 119 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q2YIF7 3.01e-05 45 40 0 60 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
P59342 3.45e-05 47 32 4 108 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
O34534 3.51e-05 47 29 3 107 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
Q940D0 3.52e-05 47 28 2 120 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P0DMC5 3.53e-05 47 31 0 105 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P96602 3.65e-05 46 28 3 108 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q9FXD6 3.93e-05 47 28 2 110 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
A7N6S2 3.95e-05 47 30 1 113 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
A6UEL7 4.01e-05 46 25 0 109 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
A6X580 4.4e-05 45 28 4 117 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1SMR4 4.71e-05 47 27 1 72 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P39928 5.57e-05 47 28 3 115 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P51586 5.58e-05 45 32 1 115 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q5N6V8 5.7e-05 47 30 2 110 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q93P00 6.38e-05 44 24 2 121 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P38889 7.44e-05 46 29 2 105 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q869S5 7.77e-05 47 40 2 65 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
P06628 8.44e-05 44 29 0 112 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
O82868 8.98e-05 45 26 0 102 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
P0AFU5 9.25e-05 46 26 0 136 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 9.25e-05 46 26 0 136 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
O49397 0.000106 46 30 2 110 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
O25408 0.00011 45 31 5 120 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q2HWG0 0.000113 43 26 3 109 2 RR13 Two-component response regulator ORR13 Oryza sativa subsp. japonica
Q8KR08 0.000127 45 22 3 199 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P31802 0.000139 45 26 3 157 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P62598 0.000156 45 30 2 110 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
P45671 0.000157 45 27 0 111 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P10958 0.000178 44 24 6 207 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P51343 0.000181 44 29 1 128 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q5SML5 0.000186 45 30 2 123 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
Q7A029 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 0.000187 44 22 4 171 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8B3I4 0.000197 45 30 2 123 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q53228 0.000207 44 27 0 107 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q6K8X6 0.000207 45 31 2 120 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
O80365 0.000214 44 29 2 95 1 ARR8 Two-component response regulator ARR8 Arabidopsis thaliana
B8AEH1 0.000217 45 31 2 120 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
P0A4I4 0.000218 44 34 1 79 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 0.000218 44 34 1 79 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P44845 0.000223 44 24 4 156 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q56128 0.000236 45 27 0 119 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q1M7A0 0.000237 44 24 5 156 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9P896 0.00024 45 27 1 111 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P06184 0.00026 44 27 0 95 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B0R4K1 0.000262 42 26 2 115 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P52688 0.000274 44 31 3 125 1 citB Transcriptional regulatory protein CitB Klebsiella pneumoniae
P58363 0.000282 45 31 3 116 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
Q86AT9 0.000289 45 27 4 123 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
A2XYV5 0.000293 43 25 3 116 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
P0AEC4 0.000298 45 31 3 116 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 0.000298 45 31 3 116 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P42508 0.000371 43 25 0 103 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
Q7XQA6 0.000383 43 25 3 117 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q54SP4 0.00042 44 29 3 113 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P58662 0.00042 44 27 0 119 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P26319 0.000469 43 22 4 164 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q54U87 0.00048 44 27 2 111 1 dhkA Hybrid signal transduction histidine kinase A Dictyostelium discoideum
P0AEV3 0.000492 43 29 0 103 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 0.000492 43 29 0 103 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 0.000492 43 29 0 103 3 rssB Regulator of RpoS Escherichia coli O157:H7
P23221 0.000512 43 25 5 197 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9AAK0 0.000623 43 27 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A4H2 0.000876 42 28 3 137 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 0.000876 42 28 3 137 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 0.000876 42 28 3 137 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9ZWS7 0.001 42 28 2 76 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
Q9SB04 0.001 42 30 1 66 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q51455 0.001 41 23 1 80 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_00330
Feature type CDS
Gene ompR
Product DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
Location 55167 - 55832 (strand: -1)
Length 666 (nucleotides) / 221 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2237
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Protein Sequence

MQILLVEDDLQLGKALCRGLELAGFRVCWLRLLADARKRLTEQHFDLMLLDLGLPDGDGFDSLVEWRNSGEQIPIIIMTARNQRDHLVNSLDSGADDFISKPVELPELISRVKAVSRRIAGFSSQLWKVDNITLNPMNHQVTLNDELLLLSGKEYQLLYELMRNTGNVVRKHELEQRLFGLDDKIESNSLEVHIHNLRRKIGKEKVITVRGIGYLLKKDSE

Flanking regions ( +/- flanking 50bp)

ACTGCAATCCGCTTTTACAGAGAGCCCGCTTTTACAGAAAGAGAGGAAACGTGCAAATTCTATTAGTCGAAGACGATTTACAATTAGGTAAAGCACTGTGCCGGGGACTGGAACTGGCCGGTTTTCGTGTGTGCTGGCTGCGTTTACTGGCCGATGCCCGTAAGCGGCTGACAGAACAGCATTTTGACCTGATGCTGCTGGATCTGGGGTTACCGGACGGCGACGGGTTTGACTCTCTGGTAGAGTGGCGCAACAGCGGGGAACAAATCCCGATTATTATTATGACCGCCCGTAATCAGCGTGATCATCTGGTCAATTCCCTCGATTCAGGGGCGGATGATTTTATTTCCAAACCGGTTGAGCTGCCGGAATTAATTTCCCGCGTTAAAGCGGTTTCCCGCCGTATTGCCGGTTTTTCCTCACAGTTATGGAAAGTGGATAATATCACCCTTAACCCGATGAACCATCAGGTAACACTGAATGACGAGTTATTACTGCTCTCCGGCAAAGAGTATCAGCTGTTATATGAATTAATGCGCAATACCGGTAATGTGGTGCGCAAACATGAGCTGGAACAGCGTTTATTCGGGCTGGACGATAAAATCGAAAGTAATTCCCTGGAAGTGCATATCCATAATCTGCGCCGCAAAATCGGTAAAGAGAAAGTGATTACCGTCCGCGGAATTGGTTATCTGCTGAAAAAGGACAGCGAATAAGTGAGAATCCGCTCATTCTTTGTTTATACCGTTCTCCTTCAGACCTTCTC