Homologs in group_2273

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17135 FBDBKF_17135 78.3 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_01755 EHELCC_01755 78.3 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_01705 NLDBIP_01705 78.3 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
LHKJJB_00330 LHKJJB_00330 78.3 Morganella morganii S3 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
HKOGLL_00370 HKOGLL_00370 78.3 Morganella morganii S5 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS05895 F4V73_RS05895 76.9 Morganella psychrotolerans - response regulator transcription factor

Distribution of the homologs in the orthogroup group_2273

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2273

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GP20 1.36e-114 329 73 0 219 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q9HV32 5.65e-56 180 46 0 214 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P66795 7.84e-51 167 43 0 216 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 7.84e-51 167 43 0 216 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q8XBS3 3.99e-50 165 41 0 216 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P52076 5.83e-50 165 41 0 216 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P36556 2.72e-47 158 40 0 216 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45337 6.29e-47 157 39 0 216 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30843 3.14e-46 155 41 0 216 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q70FH0 7.56e-46 154 41 0 218 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
A0R3I8 8.81e-38 134 36 3 225 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45607 3.15e-37 132 35 4 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
A1TEL7 4.58e-37 132 37 6 230 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8X738 5.06e-37 132 35 1 221 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P23836 6.84e-37 131 35 1 221 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q83RR0 9.45e-37 131 35 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 9.45e-37 131 35 1 221 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q02540 1.13e-36 131 36 2 224 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q8Z7H2 1.18e-36 131 35 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P45606 1.5e-36 130 34 4 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 1.8e-36 130 34 4 219 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.8e-36 130 34 4 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
Q9I0I1 1.94e-36 130 38 2 216 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55701 2.19e-36 130 34 2 221 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0DM78 2.55e-36 130 35 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 2.55e-36 130 35 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 2.55e-36 130 35 1 221 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 2.55e-36 130 35 1 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 2.55e-36 130 35 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC3 3.6e-36 129 35 1 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P0CL17 4.27e-36 129 35 4 221 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 4.27e-36 129 35 4 221 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P0DMK7 4.52e-36 129 34 2 221 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 4.52e-36 129 34 2 221 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q742C1 4.55e-36 129 36 5 228 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9CD68 4.55e-36 129 36 5 228 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A0QBQ9 4.55e-36 129 36 5 228 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q1B3X8 6.2e-36 129 36 5 228 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 6.2e-36 129 36 5 228 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 6.2e-36 129 36 5 228 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P45605 6.44e-36 129 34 4 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
A0PWB4 1.34e-35 128 36 5 230 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
A1KHB7 1.12e-34 126 35 5 228 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.12e-34 126 35 5 228 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 1.94e-34 125 35 5 228 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.94e-34 125 35 5 228 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.94e-34 125 35 5 228 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q55933 4.74e-34 124 35 4 228 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8H358 4.89e-34 124 36 3 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 4.89e-34 124 36 3 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0ACZ8 2.45e-32 120 35 5 227 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.45e-32 120 35 5 227 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.45e-32 120 35 5 227 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P9WGL9 3.68e-32 119 34 5 226 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 3.68e-32 119 34 5 226 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 3.68e-32 119 34 5 226 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q47456 9.59e-32 118 33 1 219 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9F868 1.09e-31 118 35 5 227 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9I4F9 1.18e-31 118 36 1 222 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WGM1 3.08e-31 117 33 3 212 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 3.08e-31 117 33 3 212 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 3.08e-31 117 33 3 212 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4L6C6 3.79e-31 116 34 6 223 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P23620 5.47e-31 116 33 5 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q50136 5.71e-31 116 32 2 212 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q01473 8.96e-31 122 36 4 233 3 rcaC Protein RcaC Microchaete diplosiphon
L7N689 2.32e-30 115 31 2 223 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7D9K0 3.35e-30 115 34 3 226 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 3.35e-30 115 34 3 226 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A6WZ81 4.41e-30 114 33 3 224 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9ZHD3 6.75e-30 113 35 7 229 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q8FZ93 1.01e-29 113 33 3 224 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.01e-29 113 33 3 224 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.01e-29 113 33 3 224 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.01e-29 113 33 3 224 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.01e-29 113 33 3 224 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.01e-29 113 33 3 224 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.01e-29 113 33 3 224 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.01e-29 113 33 3 224 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q9KM23 1.02e-29 113 33 3 217 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A4I0 1.1e-29 113 32 1 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.1e-29 113 32 1 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P76340 1.17e-29 112 32 5 221 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P0A4H8 1.76e-29 112 31 3 222 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.76e-29 112 31 3 222 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q7A1J1 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 7.91e-29 110 31 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 7.91e-29 110 31 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 7.91e-29 110 31 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 7.91e-29 110 31 4 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 7.91e-29 110 31 4 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P32040 7.98e-29 111 32 3 228 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P54884 1.63e-28 109 36 5 193 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q52990 9.81e-28 108 34 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P0C001 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.07e-27 107 31 6 222 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.07e-27 107 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q49XM7 2.49e-27 107 32 6 223 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5HLN2 3.84e-27 106 31 2 224 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q47744 7.27e-27 105 29 2 220 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
O06978 9.64e-27 105 32 4 223 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q8CN92 1.64e-26 104 31 2 224 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P9WGN1 1.81e-26 104 31 3 220 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.81e-26 104 31 3 220 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q44006 1.91e-26 104 29 2 223 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0A4I2 3.06e-26 103 32 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 3.06e-26 103 32 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8CP82 3.49e-26 103 33 6 223 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
O34903 5.3e-26 103 29 2 223 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P39663 6.99e-26 103 33 4 234 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5HPC3 1.26e-25 102 33 6 223 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O69730 1.9e-25 102 31 3 223 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q99U73 2.03e-25 101 31 6 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q93CB8 2.78e-25 101 35 2 217 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 2.85e-25 101 35 2 217 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 2.85e-25 101 35 2 217 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 2.85e-25 101 35 2 217 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P21866 3.44e-25 101 30 3 220 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
A0QTK2 3.92e-25 101 35 2 217 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P0AE90 4.14e-25 101 35 5 228 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 4.14e-25 101 35 5 228 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 4.14e-25 101 35 5 228 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q55890 5.36e-25 101 33 7 233 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CCJ2 5.96e-25 100 35 2 217 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q2FWH6 1.27e-24 100 30 3 220 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P94413 1.28e-24 100 30 4 223 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q8DPL7 1.82e-24 99 30 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.82e-24 99 30 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.82e-24 99 30 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CQK0 3.18e-24 99 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 3.18e-24 99 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49ZT8 3.3e-24 99 30 2 215 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0A0H3GGB5 3.64e-24 99 34 4 227 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q4LAJ9 4e-24 99 30 4 230 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P28835 8.19e-24 98 30 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
A0A4P7TS68 1.78e-23 97 32 5 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.78e-23 97 32 5 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.78e-23 97 32 5 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.78e-23 97 32 5 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.78e-23 97 32 5 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.78e-23 97 32 5 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.78e-23 97 32 5 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.78e-23 97 32 5 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P35163 1.84e-23 97 30 3 226 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q7A216 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.94e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.94e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.94e-23 97 30 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.94e-23 97 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P44895 2.32e-23 96 35 4 224 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45189 2.42e-23 96 32 2 174 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L8L9 2.92e-23 96 29 2 215 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
A6QJK3 2.92e-23 96 30 5 228 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 2.92e-23 96 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q8CQ17 4.28e-23 95 30 5 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 4.28e-23 95 30 5 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q82EB1 4.55e-23 96 31 5 235 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9ZEP4 4.8e-23 95 30 2 229 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P42244 5.62e-23 95 32 3 224 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q31S42 5.66e-23 96 31 5 230 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O78428 6.85e-23 95 30 7 233 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q2YZ24 7.16e-23 95 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P51358 8.14e-23 95 29 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 1.29e-22 95 29 4 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q4A160 1.34e-22 94 30 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A039 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 1.39e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 1.54e-22 94 30 5 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P37478 2.36e-22 94 32 5 228 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q9AE24 3.75e-22 93 28 4 225 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P28257 5.13e-22 93 30 7 238 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P48259 2.01e-21 91 29 4 233 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P13792 2.03e-21 91 31 3 231 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P94504 1.33e-19 87 27 4 223 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
G3XCY6 2.01e-19 86 33 8 233 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P69228 2.29e-19 86 30 5 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 2.29e-19 86 30 5 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O31432 2.72e-19 85 30 6 217 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
Q7A0U4 4.35e-19 85 27 3 233 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4.35e-19 85 27 3 233 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4.35e-19 85 27 3 233 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4.35e-19 85 27 3 233 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4.35e-19 85 27 3 233 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4.35e-19 85 27 3 233 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4.35e-19 85 27 3 233 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4.35e-19 85 27 3 233 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P08368 1.5e-18 84 30 7 230 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q9TLQ4 3.48e-18 83 27 4 235 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q06239 3.82e-18 82 30 6 229 3 vanR Regulatory protein VanR Enterococcus faecium
P31079 8.85e-18 82 28 4 231 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q49VK3 1.31e-17 81 29 4 224 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9K621 3.32e-17 80 27 6 233 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O24973 6.03e-17 79 30 7 231 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8CQ37 3.11e-16 77 27 3 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 3.11e-16 77 27 3 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q07597 4.29e-16 77 24 3 222 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q8DN02 8.05e-16 76 26 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 8.05e-16 76 26 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P54443 9e-16 76 30 6 208 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P42421 1.37e-15 75 27 5 230 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q6GJ11 2.24e-15 75 27 6 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q7A1L2 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 4.18e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8Z181 4.22e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 4.22e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 4.22e-15 74 26 5 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 4.22e-15 74 26 5 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 4.22e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q04942 4.76e-15 74 33 2 220 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2YSS2 5.24e-15 74 26 5 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q04803 7.55e-15 75 32 5 225 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q932F1 7.57e-15 73 26 5 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P58357 9.5e-15 73 27 7 230 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P38684 1.21e-14 73 27 6 230 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
O32192 3.24e-14 72 26 3 218 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q4L481 1.02e-13 70 25 3 222 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
O34951 1.04e-13 70 24 3 226 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
Q07783 2.45e-13 70 26 5 235 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q44929 6.93e-13 68 30 4 189 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
O25918 1.01e-12 67 27 6 218 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P33112 2.36e-12 67 28 3 176 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P50350 2.95e-12 67 26 5 238 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q9HUI2 3.53e-12 67 31 7 193 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P50351 1.48e-11 65 25 5 239 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P13359 1.54e-11 65 24 8 235 3 virG Regulatory protein VirG Rhizobium rhizogenes
O05251 4.12e-11 63 30 2 127 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q3LWR6 1.48e-10 62 27 6 204 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.48e-10 62 27 6 204 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.48e-10 62 27 6 204 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8FUS8 3.37e-10 61 26 8 216 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 3.37e-10 61 26 8 216 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 3.37e-10 61 26 8 216 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 3.37e-10 61 26 8 216 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q05943 3.49e-10 61 29 4 155 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0C5S5 4.97e-10 62 48 0 68 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.97e-10 62 48 0 68 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q87MX7 5.21e-10 62 48 0 68 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9I4N3 2.26e-09 60 30 1 140 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P07545 2.74e-09 58 24 8 237 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P44918 3.34e-09 58 23 5 227 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P28787 4.15e-09 59 30 0 112 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
A5VW00 5.5e-09 57 24 7 215 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P62722 8.39e-09 57 26 8 241 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P09432 9.18e-09 58 27 0 111 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P10576 1.11e-08 58 29 3 133 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P25852 1.38e-08 57 33 2 106 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KT84 1.41e-08 57 42 0 68 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z333 1.47e-08 57 33 2 106 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P52108 1.93e-08 56 27 4 232 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q7MM78 2.01e-08 57 37 0 96 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.01e-08 57 37 0 96 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P0AFB8 2.02e-08 57 32 1 115 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.02e-08 57 32 1 115 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q04848 2.55e-08 57 30 2 114 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9APD9 2.63e-08 57 33 2 106 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q88RJ6 2.67e-08 57 33 0 106 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0A9Q4 2.85e-08 55 24 6 229 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.85e-08 55 24 6 229 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.85e-08 55 24 6 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.85e-08 55 24 6 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P10046 4.34e-08 56 29 0 118 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
O82868 5.92e-08 54 31 0 101 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q1XDE4 5.92e-08 54 31 3 145 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P41789 6.25e-08 55 31 1 115 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q88AQ2 8.5e-08 55 31 0 106 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q00934 1e-07 55 38 0 73 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P30198 1.06e-07 53 28 2 146 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
Q06065 1.3e-07 54 29 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P03029 1.34e-07 54 31 1 113 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P10577 1.59e-07 54 29 2 111 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q5A4X5 1.77e-07 54 32 3 107 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
P42508 1.95e-07 52 31 0 101 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
Q8KR08 2.22e-07 53 25 5 202 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q8X613 2.95e-07 53 31 2 106 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P23747 3.08e-07 53 31 0 106 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44444 4.46e-07 52 26 6 235 3 virG Regulatory protein VirG Rhizobium radiobacter
P15940 4.52e-07 52 32 3 124 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P14375 4.52e-07 53 31 2 106 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P13632 9.69e-07 52 28 0 112 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q9HU19 1.5e-06 51 32 2 115 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7CQM8 1.69e-06 50 32 2 108 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38889 2.33e-06 51 30 2 113 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P51343 2.77e-06 49 34 1 119 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P40138 3.07e-06 50 33 2 108 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P52931 4.43e-06 49 37 1 78 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P39486 7.35e-06 48 31 2 104 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q10WZ6 8.14e-06 49 26 6 163 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q93P00 1.12e-05 47 26 1 88 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q8D0P1 1.21e-05 46 26 1 87 3 cheY Chemotaxis protein CheY Yersinia pestis
P48359 1.7e-05 47 27 1 120 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P45671 1.86e-05 48 29 2 115 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q9P4U6 1.88e-05 48 34 1 78 1 tcsB Two-component system protein B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A2XE31 1.91e-05 48 29 3 122 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q53228 2.13e-05 47 30 0 101 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8H7S7 2.14e-05 48 29 3 122 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
P0C5S3 2.19e-05 47 29 0 101 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
A1SMR4 2.37e-05 47 36 3 77 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
O14283 2.6e-05 48 33 4 107 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
G7WMP8 3.07e-05 46 27 3 132 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
P48027 3.41e-05 47 35 1 70 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P23221 3.9e-05 46 25 5 197 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6UEL7 4.5e-05 46 29 0 101 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
G0SB31 5.49e-05 47 28 2 104 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q6YVX7 6.59e-05 46 31 1 67 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. japonica
Q4GZK9 6.59e-05 46 31 1 67 2 RR2 Two-component response regulator ORR2 Oryza sativa subsp. indica
P24086 8.92e-05 44 26 1 119 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 8.92e-05 44 26 1 119 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q54RP6 0.000108 46 28 2 119 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
O25408 0.000116 45 32 6 125 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P31802 0.000121 45 27 2 161 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q9RC52 0.000122 45 31 0 82 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P9WGM3 0.000154 44 38 2 73 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 0.000154 44 38 2 73 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9F8D7 0.00021 45 32 1 70 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q54YZ9 0.00023 45 34 3 108 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q5SML4 0.000298 45 28 5 139 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 0.000298 45 28 5 139 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
P58363 0.000304 45 33 6 118 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
Q9SXL4 0.000306 45 29 2 84 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q9HV27 0.000308 44 35 1 79 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AEC4 0.000315 44 33 6 118 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 0.000315 44 33 6 118 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
E0X9C7 0.000361 44 37 2 79 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
B8GZM2 0.000467 44 35 2 77 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 0.000467 44 35 2 77 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q54SP4 0.000469 44 35 2 70 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
A5W4E3 0.000471 44 37 2 79 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9WY30 0.000491 43 26 2 102 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P10958 0.000543 43 23 5 206 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q54SK5 0.000549 44 32 3 123 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q8FGP6 0.00056 42 22 1 87 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE69 0.000566 42 22 1 87 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 0.000566 42 22 1 87 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 0.000566 42 22 1 87 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P39928 0.000608 43 28 3 115 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9ZCY9 0.000636 43 26 1 111 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q51455 0.000673 41 25 1 84 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UL27 0.00069 43 26 1 111 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68WH4 0.000716 43 26 1 111 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P06534 0.000787 43 37 2 79 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P72781 0.000886 42 29 2 116 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KSB1 0.001 43 34 1 75 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08300
Feature type CDS
Gene -
Product response regulator transcription factor
Location 1813416 - 1814081 (strand: 1)
Length 666 (nucleotides) / 221 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2273
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Protein Sequence

MNILLVEDDLQLGKALCRGLEIAGFQPCWVRLLADARVQLNQKAFDLMLLDLGLPDGDGQDELIALRKSGEKIPIIILTARTQIDNLVQTLDSGADDFLPKPFAMPELISRVKAVSRRMAGFSSQIWSIGDLQLNPSNHQVTLNGELLLLSGKEYQLLYELMRNTDNVVRKSDLEQRLFGLDDKIESNSLEVHMHNLRRKIGKERIITVRGIGYLLKKEVN

Flanking regions ( +/- flanking 50bp)

CTTTATTTGCCTTTTATACTTTCTTAAAGCATATTTTGATAGGTGTTATTATGAATATTTTATTAGTTGAAGACGATCTGCAATTGGGAAAGGCGCTCTGTCGTGGTTTAGAAATTGCTGGTTTTCAGCCCTGCTGGGTAAGATTGCTTGCGGATGCACGTGTTCAATTAAACCAAAAAGCCTTTGATTTAATGTTGCTTGATCTAGGTCTTCCTGATGGTGATGGTCAAGATGAGCTTATCGCACTAAGAAAAAGTGGTGAAAAAATACCCATTATTATTTTGACGGCTCGTACTCAAATAGATAACTTAGTACAAACATTAGATTCAGGTGCCGACGATTTCTTACCAAAACCTTTTGCTATGCCTGAATTAATTTCTCGTGTAAAAGCCGTAAGTCGCCGTATGGCCGGTTTCTCTTCACAGATTTGGTCTATTGGTGATTTACAGCTTAATCCCTCGAATCATCAAGTCACTTTAAATGGTGAACTATTGTTATTATCAGGTAAAGAGTACCAGTTATTATATGAGCTGATGCGCAATACAGATAATGTAGTACGTAAATCTGATTTAGAACAACGCTTATTTGGCTTAGATGACAAAATTGAAAGTAACTCACTTGAAGTTCATATGCACAACTTACGCCGTAAAATAGGCAAAGAGCGTATTATTACGGTTCGCGGTATCGGTTATCTCTTAAAAAAAGAAGTGAACTAAATGAAGATCCGCTCTTTCTTTATTTATACTATCTTTCTACAAACGATATC