Homologs in group_320

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09410 FBDBKF_09410 95.9 Morganella morganii S1 potB spermidine/putrescine ABC transporter permease PotB
EHELCC_10000 EHELCC_10000 95.9 Morganella morganii S2 potB spermidine/putrescine ABC transporter permease PotB
NLDBIP_10345 NLDBIP_10345 95.9 Morganella morganii S4 potB spermidine/putrescine ABC transporter permease PotB
LHKJJB_11010 LHKJJB_11010 95.9 Morganella morganii S3 potB spermidine/putrescine ABC transporter permease PotB
HKOGLL_14070 HKOGLL_14070 95.9 Morganella morganii S5 potB spermidine/putrescine ABC transporter permease PotB
F4V73_RS10555 F4V73_RS10555 89.8 Morganella psychrotolerans potB spermidine/putrescine ABC transporter permease PotB
PMI_RS13485 PMI_RS13485 77.6 Proteus mirabilis HI4320 potB spermidine/putrescine ABC transporter permease PotB

Distribution of the homologs in the orthogroup group_320

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_320

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFK5 2.54e-17 75 71 0 49 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 2.54e-17 75 71 0 49 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 3.41e-17 74 71 0 49 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 3.41e-17 74 71 0 49 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 3.41e-17 74 71 0 49 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
P45170 8.97e-06 43 38 0 49 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19760
Feature type CDS
Gene -
Product hypothetical protein
Location 120 - 269 (strand: -1)
Length 150 (nucleotides) / 49 (amino acids)

Contig

Accession ZDB_767
Length 293 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_320
Orthogroup size 8
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1176 Amino acid transport and metabolism (E) E ABC-type spermidine/putrescine transport system, permease component I

Protein Sequence

MIIGTSFLTRNDAILVDMVFTLDNYRRLFDPMYAQVMLHSFNMAVSATV

Flanking regions ( +/- flanking 50bp)

TGTTTGTTTTCCTGCCCAATCTGATGATCATCGGCACCAGTTTCCTGACACGCAATGACGCGATTCTGGTCGATATGGTCTTTACCCTCGACAATTACCGCCGCTTGTTTGACCCGATGTACGCACAGGTAATGCTGCACTCGTTCAATATGGCGGTGAGTGCCACGGTCTGATGCCTGCTGATCGGCTATCCTTTTGCGGCGTTTATTGCAAGGATGCCGGA