Homologs in group_197

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11805 FBDBKF_11805 100.0 Morganella morganii S1 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
EHELCC_14500 EHELCC_14500 100.0 Morganella morganii S2 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
NLDBIP_15595 NLDBIP_15595 100.0 Morganella morganii S4 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
LHKJJB_15015 LHKJJB_15015 100.0 Morganella morganii S3 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
F4V73_RS14850 F4V73_RS14850 92.0 Morganella psychrotolerans - SIS domain-containing protein
PMI_RS10455 PMI_RS10455 20.8 Proteus mirabilis HI4320 - MurR/RpiR family transcriptional regulator
PMI_RS13900 PMI_RS13900 60.5 Proteus mirabilis HI4320 - SIS domain-containing protein
PMI_RS17480 PMI_RS17480 24.5 Proteus mirabilis HI4320 - MurR/RpiR family transcriptional regulator

Distribution of the homologs in the orthogroup group_197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8ADG3 1.39e-80 248 44 0 284 3 murR HTH-type transcriptional regulator MurR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NPW3 5.06e-74 231 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LKK8 5.64e-74 231 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LMM1 5.7e-74 231 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SMS-3-5 / SECEC)
A9MIE1 6.54e-74 231 41 0 285 3 murR HTH-type transcriptional regulator MurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C6UMS6 1.42e-73 230 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / REL606)
C5W7D8 1.42e-73 230 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / BL21-DE3)
P77245 1.47e-73 229 43 0 274 1 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12)
B1XA98 1.47e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / DH10B)
C4ZVV8 1.47e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / MC4100 / BW2952)
Q32DC7 1.62e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Shigella dysenteriae serotype 1 (strain Sd197)
C6UQ16 3.89e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5YZX2 3.89e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBJ3 3.89e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7
B7LCH1 3.98e-73 229 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain 55989 / EAEC)
B2TX16 5.39e-73 228 44 0 264 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I503 5.76e-73 228 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SE11)
B7M6T6 5.76e-73 228 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O8 (strain IAI1)
A7ZPM7 5.76e-73 228 43 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0T281 1.05e-72 227 44 0 264 3 murR HTH-type transcriptional regulator MurR Shigella flexneri serotype 5b (strain 8401)
A8A2S4 1.26e-72 227 42 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O9:H4 (strain HS)
B1IX45 1.56e-72 227 42 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q3YZB5 1.61e-72 227 42 0 274 3 murR HTH-type transcriptional regulator MurR Shigella sonnei (strain Ss046)
Q83K75 2.25e-72 226 43 0 264 3 murR HTH-type transcriptional regulator MurR Shigella flexneri
Q31Y52 2.33e-72 227 44 0 264 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 4 (strain Sb227)
B7N617 2.78e-72 226 42 0 274 3 murR HTH-type transcriptional regulator MurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P37767 9.87e-54 179 38 1 271 4 yfhH Uncharacterized HTH-type transcriptional regulator YfhH Escherichia coli (strain K12)
P44540 9.88e-39 140 34 2 269 4 HI_0143 Uncharacterized HTH-type transcriptional regulator HI_0143 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8RD36 4.15e-37 135 31 1 274 4 TTE0211 Uncharacterized HTH-type transcriptional regulator TTE0211 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P26833 3.4e-34 128 26 1 270 4 CPE0189 Uncharacterized HTH-type transcriptional regulator CPE0189 Clostridium perfringens (strain 13 / Type A)
Q97MK5 1.32e-30 119 27 1 275 4 CA_C0191 Uncharacterized HTH-type transcriptional regulator CA_C0191 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q45581 5.23e-29 114 27 3 283 1 ybbH Uncharacterized HTH-type transcriptional regulator YbbH Bacillus subtilis (strain 168)
Q9WYG1 1.74e-27 110 29 3 271 4 TM_0326 Uncharacterized HTH-type transcriptional regulator TM_0326 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0ACS7 3.19e-24 102 27 1 257 1 rpiR HTH-type transcriptional regulator RpiR Escherichia coli (strain K12)
P0ACS8 3.19e-24 102 27 1 257 3 rpiR HTH-type transcriptional regulator RpiR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q63RQ7 6.2e-23 101 27 4 267 3 glk Bifunctional protein glk Burkholderia pseudomallei (strain K96243)
Q3JPP0 6.26e-23 101 27 4 267 3 glk Bifunctional protein glk Burkholderia pseudomallei (strain 1710b)
Q62HW8 6.38e-23 101 27 4 267 3 glk Bifunctional protein glk Burkholderia mallei (strain ATCC 23344)
Q2SYA5 6.62e-23 101 27 4 267 3 glk Bifunctional protein glk Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1BYA7 1.01e-21 98 26 4 267 3 glk Bifunctional protein glk Burkholderia orbicola (strain AU 1054)
Q39IQ1 1.19e-21 97 26 4 267 3 glk Bifunctional protein glk Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q143F8 1.32e-21 97 26 4 267 3 glk Bifunctional protein glk Paraburkholderia xenovorans (strain LB400)
P46117 1.5e-21 94 25 2 247 4 None Uncharacterized HTH-type transcriptional regulator in aarA 3'region Providencia stuartii
Q88P32 1.43e-19 89 26 3 264 1 hexR HTH-type transcriptional regulator HexR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P46118 5.89e-16 79 23 2 271 3 hexR HTH-type transcriptional regulator HexR Escherichia coli (strain K12)
O68281 1.01e-15 79 25 3 254 3 hexR HTH-type transcriptional regulator HexR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O28478 5.07e-14 72 31 1 145 1 AF_1796 Uncharacterized protein AF_1796 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9LBW5 2.29e-10 62 29 2 171 2 rmpB 3-hexulose-6-phosphate isomerase Mycobacterium gastri
P45313 1.17e-07 55 28 7 180 3 HI_1678 Probable arabinose 5-phosphate isomerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9YAK0 4.49e-07 53 30 3 139 3 APE_1940.1 Uncharacterized protein APE_1940.1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q9HVW0 7e-07 53 32 5 152 1 kdsD Arabinose 5-phosphate isomerase KdsD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9Z826 2.56e-06 51 28 2 145 3 CPn_0526 Uncharacterized protein CPn_0526/CP_0226/CPj0526/CpB0547 Chlamydia pneumoniae
P42404 3.43e-06 50 26 1 134 1 hxlB 3-hexulose-6-phosphate isomerase Bacillus subtilis (strain 168)
O67500 3.61e-06 51 29 6 186 3 aq_1546 Uncharacterized phosphosugar isomerase aq_1546 Aquifex aeolicus (strain VF5)
Q47334 4.06e-06 51 27 7 182 3 kpsF Arabinose 5-phosphate isomerase KpsF Escherichia coli
Q8FDQ2 4.69e-06 50 27 7 182 1 kpsF Arabinose 5-phosphate isomerase KpsF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42502 6.74e-06 50 27 7 182 3 kpsF Arabinose 5-phosphate isomerase KpsF Escherichia coli
Q8Z4C7 9.38e-06 50 28 4 152 3 gutQ Arabinose 5-phosphate isomerase GutQ Salmonella typhi
Q8ZMJ9 1.59e-05 49 28 4 152 3 gutQ Arabinose 5-phosphate isomerase GutQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P54717 5.29e-05 47 21 7 241 2 glvR HTH-type transcriptional regulator GlvR Bacillus subtilis (strain 168)
Q9PJZ7 0.00011 46 25 4 172 3 TC_0679 Uncharacterized protein TC_0679 Chlamydia muridarum (strain MoPn / Nigg)
O26351 0.000122 45 23 3 140 3 MTH_249 Uncharacterized protein MTH_249 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8FEN7 0.000124 46 28 4 152 3 gutQ Arabinose 5-phosphate isomerase GutQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P17115 0.000131 46 28 4 152 1 gutQ Arabinose 5-phosphate isomerase GutQ Escherichia coli (strain K12)
Q8X4S5 0.000131 46 28 4 152 3 gutQ Arabinose 5-phosphate isomerase GutQ Escherichia coli O157:H7
Q83MK2 0.000138 46 28 4 152 3 gutQ Arabinose 5-phosphate isomerase GutQ Shigella flexneri
A6VKY9 0.000248 45 37 1 83 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5NGP7 0.000389 45 29 7 166 1 kdsD Arabinose 5-phosphate isomerase KdsD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q6LL16 0.000413 44 35 1 87 3 murQ N-acetylmuramic acid 6-phosphate etherase Photobacterium profundum (strain SS9)
Q0I1F8 0.000696 44 37 1 83 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 129Pt)
B0UW11 0.000857 43 37 1 83 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 2336)
Q9ZD42 0.001 43 28 4 116 3 RP505 Uncharacterized protein RP505 Rickettsia prowazekii (strain Madrid E)
B8F4V1 0.001 43 36 1 83 3 murQ N-acetylmuramic acid 6-phosphate etherase Glaesserella parasuis serovar 5 (strain SH0165)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19270
Feature type CDS
Gene rpiR
Product DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
Location 93 - 953 (strand: 1)
Length 861 (nucleotides) / 286 (amino acids)

Contig

Accession ZDB_713
Length 13350 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_197
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01380 SIS domain
PF01418 Helix-turn-helix domain, rpiR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1737 Transcription (K) K DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15835 RpiR family transcriptional regulator, murPQ operon repressor - -

Protein Sequence

MAILTKISWVKAELATNQQHIADFILAQPEETVTLSSQVLAERVGVSQSAIVKFSQKLGFKGFPALKVAISEEIGRNRVLAANQQQALHNRIEAHDPLLVIAQKLAQEKQNSITETTRRLDFEQMAEIVACLDNARCIQVAGIGGSGLTAKDLAYKLQKIGLMTLAEADHHIQIAFSQTLTEKDVLVVLSFSGKRKDMLVTAATAKKQNATLIAITGNRQSPLAKMADYVLETVAEENEWRSSSISSRTAQNTVTDLLFMALLQRREEQARRLVINARTMINSLDG

Flanking regions ( +/- flanking 50bp)

TAAAATAATTTATTCCTTTTTTATTCTCCGCAGAAGGAAAACAGGTACACATGGCGATCCTGACAAAAATCAGCTGGGTAAAAGCAGAGCTGGCGACCAATCAGCAGCATATTGCCGATTTCATCCTGGCGCAGCCGGAAGAAACCGTGACACTTTCCTCTCAGGTACTGGCGGAGCGGGTGGGCGTGAGTCAGTCCGCTATAGTGAAGTTTAGTCAGAAACTGGGATTTAAGGGTTTTCCGGCACTGAAAGTCGCTATCAGCGAAGAGATTGGCCGCAACCGGGTGCTGGCAGCTAATCAGCAGCAGGCGCTGCATAACCGGATAGAAGCACATGATCCGCTGCTGGTGATCGCGCAGAAACTGGCACAGGAAAAGCAGAATTCCATTACGGAAACCACACGGCGGCTCGATTTTGAACAGATGGCAGAGATTGTCGCCTGTCTGGATAATGCCCGCTGTATTCAGGTCGCCGGTATCGGCGGCTCCGGGCTGACGGCGAAAGATCTGGCCTATAAACTTCAGAAAATCGGGCTGATGACACTGGCGGAAGCCGATCACCATATTCAGATCGCTTTTTCCCAGACGCTGACCGAAAAGGATGTGCTGGTGGTATTGTCATTCAGCGGCAAACGCAAGGATATGCTGGTCACCGCCGCCACGGCGAAAAAACAGAATGCCACGCTGATTGCGATTACCGGGAACCGTCAGTCACCGCTGGCAAAAATGGCGGATTATGTGCTGGAAACGGTCGCGGAAGAAAACGAGTGGCGCAGTTCGTCTATTTCCTCACGGACGGCGCAGAATACAGTGACGGATCTGCTGTTTATGGCGCTGTTACAGCGGCGGGAAGAGCAGGCGCGGCGGCTGGTGATCAATGCCCGCACCATGATTAACAGCCTGGACGGCTGATAAGAAAAGAGAGCGGCAGGGGCCGCTCTTTATCATTTACTGATTTTCAA