Homologs in group_1506

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09220 FBDBKF_09220 100.0 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_10190 EHELCC_10190 100.0 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
NLDBIP_10535 NLDBIP_10535 100.0 Morganella morganii S4 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
LHKJJB_10820 LHKJJB_10820 100.0 Morganella morganii S3 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
F4V73_RS10750 F4V73_RS10750 89.9 Morganella psychrotolerans - ABC transporter ATP-binding protein
PMI_RS13190 PMI_RS13190 55.9 Proteus mirabilis HI4320 - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1506

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1506

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57243 5.11e-80 244 51 0 245 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57399 6.93e-52 172 34 6 264 1 molC Molybdate import ATP-binding protein MolC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q92AF9 1.17e-44 153 34 2 213 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P49938 1.41e-43 151 32 1 239 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q8Y651 5.21e-41 144 33 2 213 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4K5Z7 6.92e-41 144 38 4 240 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P15031 7.07e-41 144 32 0 238 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q2SB47 8.61e-40 141 35 2 231 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
O34338 9.12e-40 141 37 2 206 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q6D645 1.34e-39 141 36 4 246 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q88DY1 2.45e-39 140 36 3 241 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q12R52 2.74e-39 140 35 3 247 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8L1U3 3.61e-39 139 38 3 243 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 3.61e-39 139 38 3 243 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q57554 3.94e-39 139 34 4 237 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q1LC89 4.52e-39 139 36 5 269 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q81V82 4.74e-39 140 30 1 240 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
Q1I4Q5 5.57e-39 139 38 4 242 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q3K6R9 6.14e-39 139 36 4 240 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q7NN36 7.08e-39 139 36 2 237 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q47087 8.58e-39 139 32 1 236 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
P07821 7.3e-38 136 35 1 224 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q8EB59 8.36e-38 136 34 4 243 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q58283 9.05e-38 137 30 1 235 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9KD30 2.64e-37 134 32 5 241 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P44662 3.71e-37 135 35 3 197 3 HI_0361 Probable iron transport system ATP-binding protein HI_0361 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q47MA5 3.95e-37 135 36 3 247 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
P23878 7.21e-37 134 30 1 229 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
O68877 1.21e-36 133 36 4 240 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 1.21e-36 133 36 4 240 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7W025 5.3e-36 131 37 3 250 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P96117 6.3e-36 131 34 2 207 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
Q70GD4 1.01e-35 130 32 3 248 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q7WEH6 1.5e-35 130 36 3 251 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q93SS1 2.14e-35 130 34 4 249 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
O34510 2.56e-35 130 33 1 203 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q2RZ08 3.87e-35 129 33 3 241 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q659V4 5.16e-35 129 32 2 238 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q32AY3 6.14e-35 129 34 4 241 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
O70014 6.48e-35 128 34 4 241 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q1R597 7.21e-35 128 34 4 241 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q8FCJ1 1.1e-34 128 34 4 241 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 1.1e-34 128 34 4 241 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7W359 1.18e-34 128 36 3 251 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8X5N2 1.6e-34 127 34 4 241 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q87J32 3.79e-34 126 34 7 241 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3ICT8 9.18e-34 125 31 3 245 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q5YVL8 1.41e-33 126 35 4 241 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
O34631 1.8e-33 129 32 2 237 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q56953 7.09e-33 124 31 2 198 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q2T3B8 1.46e-32 123 34 3 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q55281 4.83e-32 121 28 4 240 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O32188 5.34e-32 121 26 1 234 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
Q66FK0 5.49e-32 121 33 3 230 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 5.49e-32 121 33 3 230 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 5.49e-32 121 33 3 230 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 5.49e-32 121 33 3 230 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
O05732 7.62e-32 120 36 4 246 3 HP_0888 Probable iron chelatin transport ATP-binding protein HP_0888 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW3 7.86e-32 120 36 4 246 3 jhp_0821 Probable iron chelatin transport ATP-binding protein jhp_0821 Helicobacter pylori (strain J99 / ATCC 700824)
Q9RZU5 8.05e-32 120 37 4 224 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8UCM5 1.06e-31 120 32 2 231 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6D4A8 1.19e-31 120 35 8 249 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q93SH7 1.57e-31 120 32 3 250 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4K441 1.59e-31 120 36 5 211 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9HQ18 1.63e-31 122 33 2 234 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 1.63e-31 122 33 2 234 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5E5I1 1.7e-31 119 32 4 237 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2J3T0 1.71e-31 120 30 3 249 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q0B697 2.46e-31 119 34 4 253 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7MMN0 2.55e-31 119 33 6 238 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 2.55e-31 119 33 6 238 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q02QT1 3.18e-31 119 35 5 229 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q0SIB7 3.96e-31 119 32 2 231 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q6N7Y6 5.07e-31 119 35 2 225 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P0A191 5.62e-31 117 34 4 236 3 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A192 5.62e-31 117 34 4 236 3 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Salmonella typhi
Q7N3S7 5.72e-31 118 32 5 241 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q88R93 7.83e-31 118 36 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7N545 7.85e-31 118 32 6 249 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8REG7 1e-30 117 30 5 248 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9HYG4 1.14e-30 118 35 5 229 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q138A9 1.17e-30 117 32 4 251 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q2NSR0 1.44e-30 117 35 3 231 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q5JEB0 1.84e-30 119 35 5 213 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q81LM1 2.9e-30 117 25 1 237 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
A1JRI2 3.17e-30 116 34 8 249 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q63NR0 3.33e-30 116 35 3 246 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 3.33e-30 116 35 3 246 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 3.33e-30 116 35 3 246 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q3K506 3.84e-30 116 34 6 229 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q66AT7 4.32e-30 115 34 8 249 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CJG3 5.5e-30 115 34 8 249 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 5.5e-30 115 34 8 249 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 5.5e-30 115 34 8 249 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q87RE5 6.75e-30 115 32 5 238 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8UIW7 8.34e-30 116 33 3 222 3 phnC Phosphonates import ATP-binding protein PhnC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1DCP5 1.08e-29 115 35 3 240 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
Q31J97 1.11e-29 115 30 5 247 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q39B28 1.19e-29 115 34 4 253 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3M5J9 1.37e-29 114 34 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9RKQ4 1.67e-29 115 32 2 231 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6G475 2.01e-29 114 30 3 236 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8PHQ3 2.01e-29 115 37 5 210 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Xanthomonas axonopodis pv. citri (strain 306)
P72477 2.06e-29 114 30 3 234 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P26050 2.2e-29 115 32 3 221 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q48CA0 2.36e-29 114 33 5 212 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3AKM8 2.57e-29 114 33 6 253 3 phnC Phosphonates import ATP-binding protein PhnC Synechococcus sp. (strain CC9605)
Q57293 3.09e-29 115 28 4 243 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q7MFA1 3.24e-29 114 32 6 240 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q8KZQ6 3.94e-29 114 35 5 211 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q1BJA5 3.99e-29 114 33 4 256 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 3.99e-29 114 33 4 256 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q4ZLS1 4.16e-29 114 33 5 212 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q1GJU0 4.17e-29 113 32 3 236 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q28QF9 4.92e-29 113 31 3 245 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q16BC5 5e-29 113 31 4 226 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q9Z8J5 5.31e-29 113 29 2 217 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
A1BC20 5.54e-29 112 33 5 233 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paracoccus denitrificans (strain Pd 1222)
Q1IGL4 5.76e-29 113 35 4 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q9KL34 5.9e-29 113 33 5 236 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q217B2 6.88e-29 113 31 3 248 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q1H0W2 7.41e-29 113 31 3 230 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P22731 8.95e-29 112 32 5 230 1 livF High-affinity branched-chain amino acid transport ATP-binding protein LivF Escherichia coli (strain K12)
A0A0H2ZLL3 1.27e-28 112 32 4 228 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8D3S8 1.34e-28 112 32 6 241 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q8Z1U0 1.62e-28 114 31 4 242 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhi
P19566 1.7e-28 114 31 4 242 1 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57GZ7 1.7e-28 114 31 4 242 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella choleraesuis (strain SC-B67)
Q0I2Z4 1.75e-28 114 30 5 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q87UI3 1.95e-28 112 33 5 212 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P48334 2.07e-28 111 29 7 247 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
Q2W4W1 2.25e-28 111 33 7 264 3 znuC Zinc import ATP-binding protein ZnuC Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q6FFL0 2.32e-28 111 32 6 238 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P42360 2.4e-28 111 30 4 236 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q4FQ27 2.42e-28 111 30 7 255 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
P27675 3.08e-28 110 32 2 204 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q21PQ7 3.21e-28 111 33 5 215 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3SQ65 3.22e-28 111 30 3 247 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9HT73 3.69e-28 111 34 6 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 3.69e-28 111 34 6 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
P44531 4.18e-28 112 30 7 237 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3ISC1 4.37e-28 110 34 5 240 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q5PKZ8 4.48e-28 113 30 4 242 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q02151 4.79e-28 110 28 3 254 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
P74981 4.9e-28 110 34 6 232 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q88ZJ6 5.51e-28 112 34 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q92N13 5.91e-28 110 31 3 248 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q1QE80 6.23e-28 113 32 5 261 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7N986 6.35e-28 112 31 5 249 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9V2E4 6.56e-28 110 35 5 230 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q0TA26 8.37e-28 112 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6F0V4 8.64e-28 112 29 5 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q5QXD0 8.8e-28 110 31 7 246 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6LQC0 9.28e-28 110 30 5 245 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q8U4L3 9.28e-28 110 35 6 217 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3YUV0 9.56e-28 112 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella sonnei (strain Ss046)
Q7UBD0 9.56e-28 112 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri
Q1R3Q1 9.56e-28 112 31 4 236 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain UTI89 / UPEC)
P68187 9.56e-28 112 31 4 236 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain K12)
P68188 9.56e-28 112 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O157:H7
Q8FB37 1.02e-27 112 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q21XJ9 1.1e-27 110 34 7 229 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9K8N1 1.14e-27 109 30 5 227 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q660M8 1.15e-27 111 33 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q89AJ0 1.15e-27 109 30 6 240 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q6CYU2 1.18e-27 110 33 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6NA00 1.24e-27 110 33 9 268 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P0A2U7 1.25e-27 108 30 4 220 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 1.25e-27 108 30 4 220 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A1WXT0 1.71e-27 109 32 6 240 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q9KQB8 1.73e-27 109 32 7 249 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O86751 1.74e-27 111 35 5 224 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q38UT9 1.79e-27 109 35 5 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
O51587 2.15e-27 110 34 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9Z3I3 2.61e-27 110 31 4 222 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q7NWX3 2.72e-27 110 34 5 216 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8UCD5 2.94e-27 110 34 3 206 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U4K3 3.23e-27 110 35 7 199 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q0SXQ1 3.24e-27 110 31 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri serotype 5b (strain 8401)
Q03AH0 3.46e-27 110 34 3 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P0A9V4 3.54e-27 108 33 4 236 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 3.54e-27 108 33 4 236 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 3.54e-27 108 33 4 236 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 3.54e-27 108 33 4 236 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
Q98GF5 4.38e-27 108 32 5 249 3 phnC Phosphonates import ATP-binding protein PhnC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8PP41 4.42e-27 108 35 3 201 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q0SWH9 4.42e-27 108 32 7 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q0A9E2 4.77e-27 108 31 8 264 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q84EY8 4.82e-27 108 30 3 244 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q1Q889 4.92e-27 107 29 6 252 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0TUN8 5.06e-27 108 32 7 216 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SML1 5.11e-27 110 33 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
O31723 5.3e-27 108 31 5 244 2 ylmA Uncharacterized ABC transporter ATP-binding protein YlmA Bacillus subtilis (strain 168)
Q39GT7 5.31e-27 108 32 4 226 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BWI2 5.71e-27 108 33 4 226 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q8XIZ5 6.08e-27 109 31 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 6.08e-27 109 31 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q9CM80 6.08e-27 109 30 7 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
P23703 6.43e-27 109 31 4 222 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q31I51 7.1e-27 107 31 6 227 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6LTB1 7.33e-27 107 28 5 238 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q97KS6 8.49e-27 109 30 3 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q73GK9 8.98e-27 107 27 7 238 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q3KKA1 9.63e-27 107 35 7 217 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q6G098 9.83e-27 107 29 3 240 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q65QT6 1.04e-26 109 30 4 245 3 malK Maltose/maltodextrin import ATP-binding protein MalK Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
O29527 1.2e-26 107 36 6 205 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7MFC4 1.3e-26 109 29 4 245 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain YJ016)
Q8D3V0 1.3e-26 109 29 4 245 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain CMCP6)
Q03PF2 1.37e-26 109 33 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0SRL2 1.46e-26 108 28 3 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q5E6M2 1.68e-26 106 31 5 238 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8CUY0 1.88e-26 106 29 4 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P45171 2.03e-26 108 29 3 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O68106 2.15e-26 107 34 6 238 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q1MMZ3 2.22e-26 107 32 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92V71 2.52e-26 106 32 4 227 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q4QK57 2.59e-26 108 29 3 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q82MV1 2.61e-26 106 33 7 229 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8G838 2.81e-26 110 33 7 259 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 2.77e-19 90 32 7 211 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q07LU3 2.85e-26 106 29 3 248 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q9KL04 3.99e-26 108 28 6 249 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0K9I2 4.07e-26 106 34 6 247 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O34362 4.09e-26 109 30 3 230 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 3.56e-20 92 29 6 232 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q30V33 4.15e-26 107 32 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q89C51 4.29e-26 105 30 5 265 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6D201 4.39e-26 107 31 5 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q92L31 4.49e-26 105 32 4 236 3 thiQ Thiamine import ATP-binding protein ThiQ Rhizobium meliloti (strain 1021)
Q87GB5 4.83e-26 107 29 4 245 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1CDR0 4.9e-26 105 34 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 4.9e-26 105 34 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 4.9e-26 105 34 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q88RL1 5.71e-26 105 32 8 249 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q665B6 6.3e-26 105 34 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q668K6 6.36e-26 107 34 2 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q04G50 6.45e-26 107 29 3 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8D0W8 7.34e-26 107 34 2 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
O69051 7.48e-26 105 35 6 241 3 ptxA Phosphite import ATP-binding protein PxtA Stutzerimonas stutzeri
Q2KDV1 8.23e-26 105 33 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3IWB5 8.65e-26 104 33 7 233 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3Z2L6 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 8.77e-26 104 31 6 236 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 8.77e-26 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q1BWL4 8.81e-26 106 32 5 216 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 8.81e-26 106 32 5 216 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
P45092 8.93e-26 104 33 4 227 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CIQ6 9.13e-26 104 29 4 227 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
O57872 9.24e-26 104 34 5 213 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q14Q07 1.03e-25 106 28 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q65UE1 1.04e-25 107 30 3 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q51719 1.04e-25 105 33 7 247 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
Q5GRS1 1.11e-25 104 26 6 237 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q63E84 1.23e-25 105 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 1.23e-25 105 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 1.23e-25 105 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q6LKD4 1.25e-25 106 28 4 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q8RD07 1.3e-25 103 31 5 221 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q39GW5 1.33e-25 105 32 6 228 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P18813 1.33e-25 105 30 5 242 3 malK Maltose/maltodextrin import ATP-binding protein MalK (Fragment) Klebsiella aerogenes
Q32HA3 1.38e-25 104 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q9CN78 1.41e-25 103 32 4 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q6HLQ9 1.52e-25 105 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q032D0 1.57e-25 103 29 4 227 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q9KLQ5 1.6e-25 105 28 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CP06 1.61e-25 106 31 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
O52618 1.7e-25 105 31 4 217 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
Q1MCZ1 1.71e-25 104 32 4 237 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0VTB6 1.84e-25 103 34 8 226 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q72FW5 1.91e-25 106 31 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q0BFQ0 1.95e-25 105 31 5 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q4ZZS2 1.96e-25 103 35 7 217 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q4L5B3 2.02e-25 105 30 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q5PIA5 2.05e-25 103 32 4 215 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 2.05e-25 103 32 4 215 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q1GMA8 2.07e-25 103 29 4 231 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q1IGY7 2.09e-25 103 31 8 249 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q7MPC5 2.12e-25 103 32 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 2.12e-25 103 32 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q2SSS4 2.18e-25 105 30 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q1BG75 2.18e-25 103 32 5 215 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 2.18e-25 103 32 5 215 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
Q8ZNV7 2.37e-25 103 33 5 215 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O85818 2.49e-25 105 29 3 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q64SQ6 2.56e-25 107 30 3 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
P40860 2.59e-25 105 31 6 260 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9V2C0 2.62e-25 105 34 6 204 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q5LBT4 2.64e-25 107 30 3 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
O57896 2.66e-25 105 35 5 199 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q2LY16 2.81e-25 103 32 6 230 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q2JB14 2.89e-25 103 32 5 242 3 phnC Phosphonates import ATP-binding protein PhnC Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q1J255 2.92e-25 103 35 5 226 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q4QP85 3.12e-25 105 31 6 245 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q6MU19 3.18e-25 105 30 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q83KR7 3.28e-25 103 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 3.28e-25 103 31 6 236 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q8Z4V6 3.37e-25 105 31 6 260 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q81TH8 3.42e-25 104 28 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
P94420 3.42e-25 103 24 3 241 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
P72335 3.46e-25 104 30 4 222 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q7N8B9 3.56e-25 105 29 4 221 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0I3Y9 3.62e-25 105 29 3 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q58967 3.78e-25 103 33 5 203 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0KPH6 3.79e-25 103 30 7 254 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8TQ05 3.96e-25 107 33 4 216 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 3.31e-17 84 29 5 225 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5E882 4.14e-25 102 32 3 221 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7N6Z2 4.18e-25 105 31 5 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5YTW4 4.44e-25 103 33 5 233 3 phnC Phosphonates import ATP-binding protein PhnC Nocardia farcinica (strain IFM 10152)
Q2JPW6 4.65e-25 103 29 5 248 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q8YK28 5.01e-25 102 36 6 214 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8U8D6 5.24e-25 103 31 4 212 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q48PV0 5.72e-25 102 34 7 217 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1LNM0 5.92e-25 103 34 7 220 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8XNY7 5.95e-25 103 31 7 216 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q832R5 6.11e-25 106 32 5 222 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.22e-10 64 28 9 226 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q7MKU3 6.22e-25 104 30 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 6.22e-25 104 30 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q1LKJ2 6.39e-25 103 30 4 235 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2SVN0 7.23e-25 103 33 6 224 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8XZQ4 7.41e-25 102 35 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3JSR6 7.77e-25 103 34 5 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q87G35 7.86e-25 106 32 7 231 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 3.01e-10 63 26 7 242 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q18KE1 7.91e-25 103 31 6 235 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q13ZK7 7.95e-25 103 31 7 240 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
Q8A883 7.97e-25 105 31 3 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q63TW1 8.02e-25 103 34 5 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
Q9A9P4 8.1e-25 101 35 5 217 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q65S66 8.14e-25 103 29 5 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q62K56 8.18e-25 103 34 5 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
P44513 8.29e-25 104 31 6 245 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7N0N3 9.27e-25 101 30 6 228 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8D385 1.11e-24 101 28 6 256 3 znuC Zinc import ATP-binding protein ZnuC Wigglesworthia glossinidia brevipalpis
Q87UN0 1.12e-24 102 34 6 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5LI72 1.12e-24 100 33 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q65TB7 1.13e-24 101 33 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9AE30 1.13e-24 102 31 4 237 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q5LYN4 1.16e-24 104 31 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q1RDS4 1.16e-24 101 33 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 1.16e-24 101 33 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q5M397 1.19e-24 104 31 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q1MQ44 1.25e-24 103 33 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q03JH1 1.25e-24 103 31 3 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q9PKX1 1.27e-24 101 27 3 235 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
Q8XXY9 1.27e-24 103 28 3 244 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4KKK4 1.28e-24 101 33 6 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3ATR5 1.3e-24 105 34 8 229 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium chlorochromatii (strain CaD3)
Q9XDA6 1.33e-24 101 28 4 222 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q07PZ0 1.34e-24 102 32 4 228 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q2IGQ6 1.38e-24 101 37 9 223 3 pstB Phosphate import ATP-binding protein PstB Anaeromyxobacter dehalogenans (strain 2CP-C)
P39456 1.43e-24 101 30 5 240 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q04EY5 1.45e-24 102 29 3 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8ESM5 1.53e-24 101 28 4 226 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q88ZZ2 1.54e-24 105 30 5 265 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 3.36e-12 69 26 6 252 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q897I2 1.58e-24 104 30 2 195 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 2.94e-07 54 29 2 113 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q926D8 1.63e-24 101 27 4 222 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9CL63 1.73e-24 105 32 2 211 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
Q9CL63 1.16e-09 61 24 5 221 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
O34946 1.74e-24 100 28 4 217 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q28VN1 1.96e-24 100 29 4 236 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
A1TXH7 1.98e-24 103 31 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P38046 1.99e-24 101 34 6 208 1 nrtD Nitrate import ATP-binding protein NrtD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q92WJ0 1.99e-24 103 33 4 218 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
O69063 2.11e-24 102 31 5 248 3 htxD Hypophosphite import ATP-binding protein HtxD Stutzerimonas stutzeri
Q132E8 2.31e-24 101 31 6 254 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q2JLH7 2.32e-24 101 30 4 226 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q5ZWE4 2.35e-24 103 30 3 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P33982 2.49e-24 101 30 6 236 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8Z5W6 2.54e-24 100 32 4 215 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q5FA19 2.64e-24 102 34 5 212 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q20Y31 2.7e-24 101 30 6 266 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q7AH43 2.74e-24 102 28 3 214 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q92UV5 2.99e-24 103 32 3 197 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
P45247 3.01e-24 100 33 4 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 3.01e-24 100 33 4 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q2IYS5 3.03e-24 101 32 4 226 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q5WXF0 3.12e-24 102 30 3 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q2GJA5 3.27e-24 100 27 7 244 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q8TYV9 3.38e-24 100 33 6 228 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q035E0 3.39e-24 100 29 6 240 3 phnC Phosphonates import ATP-binding protein PhnC Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8RD43 3.69e-24 103 29 2 218 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 5.73e-11 65 22 8 230 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q70YG7 3.75e-24 100 30 6 239 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q74K65 3.77e-24 102 31 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q7VNG4 3.96e-24 102 30 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q64Z80 4.28e-24 99 31 4 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain YCH46)
Q98L75 4.36e-24 100 29 4 242 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q93DX8 4.4e-24 100 31 4 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q8FFB3 5.58e-24 102 32 2 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1LJ08 5.72e-24 100 31 5 243 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q81GC1 5.99e-24 101 27 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8XBJ8 5.99e-24 102 32 2 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q2SVP3 6.09e-24 100 31 3 219 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q81GU1 6.11e-24 101 32 2 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P16676 6.17e-24 102 32 2 212 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
P37009 6.25e-24 101 30 5 216 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q6D734 6.87e-24 101 30 3 203 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5DZC6 7.39e-24 101 28 3 211 3 malK Maltose/maltodextrin import ATP-binding protein MalK Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5L222 7.48e-24 101 29 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q6LK87 7.7e-24 101 27 4 245 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photobacterium profundum (strain SS9)
Q9KS33 7.73e-24 102 29 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q60AI1 7.88e-24 102 34 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q63TY1 8.31e-24 101 32 6 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q5E586 8.39e-24 101 30 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
P45073 8.54e-24 99 28 4 237 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8RI39 8.8e-24 101 31 4 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
O84071 8.8e-24 99 26 3 234 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q62K82 9.48e-24 101 32 6 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q6MUF4 9.55e-24 99 31 6 233 3 phnC Phosphonates import ATP-binding protein PhnC Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q3JSQ0 9.78e-24 100 32 4 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 9.78e-24 100 32 4 220 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q63TX3 9.99e-24 100 32 4 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q57BC2 1.03e-23 99 33 5 231 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus biovar 1 (strain 9-941)
Q2YLW6 1.03e-23 99 33 5 231 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus (strain 2308)
Q3IQI3 1.09e-23 99 34 5 226 3 pstB2 Phosphate import ATP-binding protein PstB 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q471U2 1.13e-23 99 31 9 261 3 tauB Taurine import ATP-binding protein TauB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2K8C8 1.16e-23 100 32 4 216 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8FJ95 1.16e-23 99 32 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6MCV4 1.16e-23 101 32 5 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q2ISN3 1.26e-23 99 31 6 254 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q0TJC1 1.26e-23 99 32 5 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
O31711 1.35e-23 98 30 5 201 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q8U6M1 1.36e-23 100 33 5 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9PJX9 1.37e-23 98 32 5 230 3 TC_0697 Probable metal transport system ATP-binding protein TC_0697 Chlamydia muridarum (strain MoPn / Nigg)
Q0BZD8 1.43e-23 99 33 4 224 3 phnC Phosphonates import ATP-binding protein PhnC Hyphomonas neptunium (strain ATCC 15444)
Q9JUX4 1.45e-23 100 32 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q664X5 1.46e-23 100 30 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CNR8 1.46e-23 100 30 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAS8 1.46e-23 100 30 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis
Q1CC21 1.46e-23 100 30 4 236 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Antiqua)
Q8FAV1 1.47e-23 99 30 7 253 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8KLG1 1.48e-23 100 29 4 229 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9YGA6 1.57e-23 100 29 5 224 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q30W28 1.64e-23 99 29 4 230 3 phnC Phosphonates import ATP-binding protein PhnC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q87PH3 1.66e-23 100 30 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DWR3 1.73e-23 99 27 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 1.73e-23 99 27 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 1.73e-23 99 27 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6NBX6 1.73e-23 99 30 6 254 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5X627 1.75e-23 100 29 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q5LUR8 1.83e-23 98 29 5 235 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0S0X2 1.89e-23 99 33 5 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
Q9JZW0 1.96e-23 100 32 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8FYU9 1.97e-23 98 32 4 230 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella suis biovar 1 (strain 1330)
Q8YJ04 1.97e-23 98 32 4 230 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7UC29 2.02e-23 100 32 2 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q6LQ77 2.24e-23 98 31 4 230 3 btuD Vitamin B12 import ATP-binding protein BtuD Photobacterium profundum (strain SS9)
Q4W575 2.26e-23 100 34 5 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 2.26e-23 100 34 5 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q6MIP7 2.28e-23 98 33 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P40790 2.44e-23 100 32 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 2.44e-23 100 32 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q5PMK1 2.57e-23 100 32 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q329I3 2.58e-23 98 30 6 250 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q7W148 2.72e-23 98 33 3 210 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9I6L0 2.74e-23 99 32 5 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Z7H7 2.84e-23 100 32 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q7WNT8 2.86e-23 98 33 3 210 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9F9B0 2.87e-23 98 31 6 218 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
Q1AVD3 2.93e-23 101 29 6 258 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVD3 1.44e-18 87 29 6 220 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q8YUV1 3.1e-23 98 29 4 245 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O31339 3.16e-23 99 31 2 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9KUI0 3.17e-23 100 33 5 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0RKH4 3.38e-23 97 34 5 210 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q1M7W6 3.53e-23 99 29 4 222 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q87SV4 3.8e-23 97 32 3 205 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q13RD3 3.86e-23 97 32 5 221 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paraburkholderia xenovorans (strain LB400)
Q50966 4.02e-23 99 33 5 211 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q578K3 4.64e-23 99 31 3 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 4.64e-23 99 31 3 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q830W6 4.68e-23 99 28 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q8A1M1 4.73e-23 96 31 5 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q13ZJ1 4.86e-23 98 33 4 219 3 nodI Nod factor export ATP-binding protein I Paraburkholderia xenovorans (strain LB400)
Q1R155 4.93e-23 97 30 6 244 3 znuC Zinc import ATP-binding protein ZnuC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5MZ54 5.01e-23 101 34 5 205 3 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55107 5.01e-23 101 34 5 205 1 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NX01 5.2e-23 99 33 6 232 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q67JX3 5.26e-23 98 32 7 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q92LU2 5.35e-23 99 33 4 206 3 modC Molybdenum import ATP-binding protein ModC Rhizobium meliloti (strain 1021)
Q0T5R2 5.46e-23 99 32 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
A0LCH8 5.58e-23 97 31 6 217 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q8DZJ0 5.77e-23 99 30 3 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 5.77e-23 99 30 3 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 5.77e-23 99 30 3 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6D4E2 5.88e-23 99 32 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8RQL7 5.94e-23 97 31 3 216 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0T9T7 6.17e-23 97 30 6 250 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P94440 6.52e-23 98 30 4 203 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q8D653 6.62e-23 99 32 3 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q9Z810 6.64e-23 97 32 5 212 3 CPn_0542 Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 Chlamydia pneumoniae
Q8YCG3 6.82e-23 99 31 3 215 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q1MCN6 7.03e-23 99 27 7 258 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9HNI8 7.04e-23 97 31 8 250 3 phnC Phosphonates import ATP-binding protein PhnC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8X5I6 7.14e-23 97 35 5 202 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
Q46ZU5 7.19e-23 97 32 5 238 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XDV7 7.21e-23 97 30 6 250 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q8EBC3 7.23e-23 99 32 6 233 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P69880 7.81e-23 97 31 8 222 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MW2)
Q6G9H4 7.81e-23 97 31 8 222 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MSSA476)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13880
Feature type CDS
Gene fepC
Product ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Location 74751 - 75524 (strand: 1)
Length 774 (nucleotides) / 257 (amino acids)
In genomic island -

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1506
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1120 Inorganic ion transport and metabolism (P)
Coenzyme transport and metabolism (H)
PH ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MSDVLTTRGLAVGYGEKLILTDINLQLHQGEIICLLGANGCGKTTLMKTLLGLLPPKAGEISIDNTPLRDWSAAALARRVAYVPQAHNMPFSFRVTDMVALGRSAHLSLFAAPGRAERQMAEQELDHLGIAHLAQRSYSCLSGGEKQLVLIARALVQQPGLLIMDEPAASLDFGNQIKLLNKIEQLRERGITVLMSTHHPQHAAAVADSIVMLSKDSPACQDKPAALLTPETLAALYHVTPEHIAAHFAQPAYKGCS

Flanking regions ( +/- flanking 50bp)

GTCGGTGCACCTTTCTTTATTTTTCTGCTGTTGCAGACCCGGAGGAACGGATGAGCGATGTCCTGACCACCCGCGGCCTGGCCGTCGGCTACGGAGAGAAGTTAATACTCACTGACATAAATCTGCAATTACATCAGGGAGAAATTATCTGTCTGCTCGGTGCCAACGGCTGCGGCAAAACCACGCTGATGAAAACCCTGCTCGGCCTGTTACCACCAAAGGCCGGGGAGATCAGCATTGATAACACACCGCTGCGTGACTGGAGTGCCGCCGCACTCGCCCGCCGCGTTGCCTATGTGCCTCAGGCGCACAATATGCCGTTTTCTTTCCGGGTGACGGATATGGTCGCGCTCGGACGCAGTGCCCACCTCTCCCTGTTTGCCGCCCCGGGACGCGCTGAACGGCAGATGGCAGAGCAGGAACTGGATCATCTGGGGATCGCCCATCTGGCACAACGCTCCTATTCCTGCCTGAGCGGCGGGGAAAAACAGCTGGTACTGATTGCCCGCGCCCTTGTACAACAGCCGGGGCTGCTGATTATGGATGAACCGGCGGCCAGCCTCGATTTCGGCAATCAGATAAAATTACTGAATAAAATCGAACAGTTACGTGAGAGAGGGATCACCGTGCTGATGTCCACCCACCACCCGCAGCATGCGGCCGCCGTGGCAGACAGCATTGTGATGCTCAGCAAAGACAGCCCCGCCTGCCAGGATAAACCTGCCGCGCTGCTCACACCGGAAACCCTGGCGGCACTCTATCATGTGACACCAGAACATATTGCTGCCCACTTCGCGCAGCCAGCTTATAAGGGATGCTCATGACTATTGATGATATCGATTTCGCACAACTCTACCGCGACCATCTCGCACAG