Homologs in group_326

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09805 FBDBKF_09805 100.0 Morganella morganii S1 sucD succinate--CoA ligase subunit alpha
EHELCC_04605 EHELCC_04605 100.0 Morganella morganii S2 sucD succinate--CoA ligase subunit alpha
NLDBIP_04605 NLDBIP_04605 100.0 Morganella morganii S4 sucD succinate--CoA ligase subunit alpha
LHKJJB_14025 LHKJJB_14025 100.0 Morganella morganii S3 sucD succinate--CoA ligase subunit alpha
F4V73_RS00540 F4V73_RS00540 97.9 Morganella psychrotolerans sucD succinate--CoA ligase subunit alpha
PMI_RS02815 PMI_RS02815 95.9 Proteus mirabilis HI4320 sucD succinate--CoA ligase subunit alpha
PMI_RS10850 PMI_RS10850 32.1 Proteus mirabilis HI4320 - acyl-CoA synthetase FdrA

Distribution of the homologs in the orthogroup group_326

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_326

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AGE9 0.0 544 94 0 289 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Escherichia coli (strain K12)
P0AGF0 0.0 544 94 0 289 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGF1 0.0 544 94 0 289 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Escherichia coli O157:H7
Q51567 0.0 511 89 0 284 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45102 2.45e-174 486 83 0 289 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P53591 3.19e-158 445 76 1 285 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q1RH56 1.93e-145 412 70 1 290 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Rickettsia bellii (strain RML369-C)
Q4ULQ8 1.33e-144 410 71 1 291 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O08371 3.74e-143 407 70 1 291 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Rickettsia prowazekii (strain Madrid E)
Q9AKE1 1.76e-140 400 68 1 291 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92I22 2.91e-140 399 69 1 291 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8LAD2 2.35e-133 384 66 2 291 1 At5g23250 Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial Arabidopsis thaliana
P68209 6.63e-133 383 66 2 291 1 At5g08300 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial Arabidopsis thaliana
Q8GTQ9 1.91e-132 381 65 2 291 1 SCOA Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial Solanum lycopersicum
P80865 1.87e-129 372 62 0 290 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Bacillus subtilis (strain 168)
Q6ZL94 1.52e-128 371 65 2 291 1 Os07g0577700 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial Oryza sativa subsp. japonica
Q8NX01 1.61e-127 368 64 0 284 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain MW2)
Q6G9W7 1.61e-127 368 64 0 284 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain MSSA476)
P99070 1.72e-127 367 64 0 284 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain N315)
P66866 1.72e-127 367 64 0 284 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGI6 1.72e-127 367 64 0 284 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain COL)
Q6GHI9 2.19e-127 367 64 0 284 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus aureus (strain MRSA252)
Q6DQL1 2.19e-126 366 67 2 282 1 None Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial Solanum lycopersicum
P36967 1.34e-124 361 67 2 291 1 scsA Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Dictyostelium discoideum
B3FHT4 2.59e-124 360 65 2 285 1 SCSa Succinate--CoA ligase [ADP-forming] subunit alpha Blastocystis sp. subtype 1 (strain ATCC 50177 / NandII)
Q5HPU4 3.97e-123 357 61 0 281 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPH4 6.57e-123 356 61 0 281 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9WUM5 1.8e-121 354 67 2 293 1 Suclg1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Mus musculus
P13086 1.31e-120 352 67 2 294 2 Suclg1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Rattus norvegicus
Q9YGD2 1.25e-116 340 64 2 294 1 SUCLG1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (Fragment) Columba livia
O28098 1.05e-115 337 57 1 288 3 sucD2 Succinate--CoA ligase [ADP-forming] subunit alpha 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P53595 1.19e-114 335 55 1 294 3 mtkB Malate--CoA ligase subunit alpha Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
O28733 2.26e-114 334 55 1 289 3 sucD1 Succinate--CoA ligase [ADP-forming] subunit alpha 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P53597 8.41e-114 334 66 2 293 1 SUCLG1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Homo sapiens
O13750 1.12e-112 331 60 2 295 3 SPAC16E8.17c Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P53596 3.25e-112 330 61 2 288 3 sucl-1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Caenorhabditis elegans
O67547 7.83e-112 328 61 1 291 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Aquifex aeolicus (strain VF5)
Q9P727 8.44e-111 326 60 2 289 3 tca-8 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O19069 9.05e-111 327 66 2 293 1 SUCLG1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Sus scrofa
Q58DR8 1.09e-110 327 66 2 293 2 SUCLG1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Bos taurus
Q94522 8.4e-107 316 59 2 288 2 Scsalpha1 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Drosophila melanogaster
O26663 2.06e-104 309 54 2 286 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q58643 1.51e-98 294 56 1 288 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P09143 1.3e-95 286 56 0 286 1 sucD Succinate--CoA ligase [GDP-forming] subunit alpha Thermus thermophilus
P9WGC7 3.89e-93 280 54 4 283 1 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGC6 3.89e-93 280 54 4 283 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7U0Z0 4.58e-93 280 54 4 283 3 sucD Succinate--CoA ligase [ADP-forming] subunit alpha Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P53598 1.8e-92 280 51 4 292 1 LSC1 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53401 3.66e-88 268 55 4 286 1 ALPHA-SCS3 Succinate--CoA ligase [ADP-forming] subunit alpha-3, mitochondrial Trichomonas vaginalis
P53400 6.44e-88 267 54 4 286 1 ALPHA-SCS2 Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial Trichomonas vaginalis
P53399 9.74e-88 267 55 4 286 1 ALPHA-SCS1 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial Trichomonas vaginalis
A0A3A6N9V6 1.65e-81 251 43 2 291 1 sqwL ADP-forming sulfoacetate-CoA ligase subunit SqwL Acholeplasma sp.
E5Y8P7 4.79e-72 226 41 2 292 1 sauD ADP-forming sulfoacetate-CoA ligase subunit SauD Bilophila wadsworthia (strain 3_1_6)
P16638 5.93e-28 116 35 9 262 1 Acly ATP-citrate synthase Rattus norvegicus
Q91V92 6.51e-28 116 35 9 262 1 Acly ATP-citrate synthase Mus musculus
P53396 1.29e-27 115 35 9 262 1 ACLY ATP-citrate synthase Homo sapiens
Q32PF2 7.15e-26 110 34 9 262 2 ACLY ATP-citrate synthase Bos taurus
Q2TCH3 8.11e-26 110 34 9 262 2 ACLY ATP-citrate synthase Ovis aries
P53585 1.17e-23 104 31 6 261 3 acly-1 Probable ATP-citrate synthase Caenorhabditis elegans
O93988 2.59e-23 102 31 7 263 3 ACL1 ATP-citrate synthase subunit 1 Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
Q8X097 6.59e-23 101 31 7 263 3 B14D6.310 Probable ATP-citrate synthase subunit 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q54YA0 1.41e-22 100 30 5 269 1 acly Probable ATP-citrate synthase Dictyostelium discoideum
Q9P7W3 2.33e-21 97 31 7 244 1 SPBC1703.07 Probable ATP-citrate synthase subunit 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9C522 3.29e-20 94 33 5 216 2 ACLB-1 ATP-citrate synthase beta chain protein 1 Arabidopsis thaliana
Q9FGX1 2.59e-19 91 34 5 216 1 ACLB-2 ATP-citrate synthase beta chain protein 2 Arabidopsis thaliana
Q93VT8 1.01e-18 89 33 5 216 2 ACLB-1 ATP-citrate synthase beta chain protein 1 Oryza sativa subsp. japonica
E7FI45 1.05e-08 59 26 9 258 1 acdAI Acetate--CoA ligase [ADP-forming] I subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A9A1Y1 1.76e-08 58 27 8 180 1 Nmar_0206 4-hydroxybutyrate--CoA ligase [ADP-forming] Nitrosopumilus maritimus (strain SCM1)
P77187 6.9e-07 53 29 3 148 4 yahF Uncharacterized protein YahF Escherichia coli (strain K12)
Q8U3D6 4.08e-05 48 25 8 207 1 acdAII Acetate--CoA ligase [ADP-forming] II subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A9A2G6 0.000642 44 25 5 184 1 Nmar_1309 3-hydroxypropionate--CoA ligase [ADP-forming] Nitrosopumilus maritimus (strain SCM1)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12510
Feature type CDS
Gene sucD
Product succinate--CoA ligase subunit alpha
Location 56056 - 56928 (strand: -1)
Length 873 (nucleotides) / 290 (amino acids)

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_326
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00549 CoA-ligase
PF02629 CoA binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0074 Energy production and conversion (C) C Succinyl-CoA synthetase, alpha subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVRDAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTCVGIGGDPIPGSNFIDILRMFQNDPQTEAIVMIGEIGGSAEEEAAAFIKDHVTKPVVAYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAILNK

Flanking regions ( +/- flanking 50bp)

AGCCTGACGGATGCTGCGAAACGTGTTGTTGCAGCAGTGGGAGCGAAATAATGTCTATTTTAATCGATAAGAACACCAAAGTTATCTGTCAGGGATTCACAGGTAGCCAGGGGACTTTCCACTCTGAACAGGCAATTGCGTACGGCACCAAAATGGTCGGCGGTGTGACGCCGGGCAAAGGCGGTACAACACATTTAGGTTTACCGGTCTTTAACACCGTGCGTGACGCGGTGGAAGCCACCGGTGCGACCGCTTCTGTTATTTATGTACCGGCACCGTTCTGCAAAGACTCCATTCTGGAAGCGATTGATGCAGGTATTAAGCTGATTATCACCATCACAGAAGGCATTCCGACCCTGGATATGCTGACCGTCAAGGTGAAACTGGATGAAGCAGGTGTACGGATGATCGGCCCGAACTGTCCGGGTGTTATCACGCCGGGTGAGTGCAAAATCGGGATCATGCCGGGACATATCCATCTGCCGGGCAAAGTGGGGATCGTTTCCCGTTCAGGTACGCTGACTTATGAAGCGGTGAAACAGACGACTGATGCCGGTCTGGGACAATCCACCTGTGTGGGTATCGGCGGTGACCCGATTCCGGGCTCTAACTTTATCGATATCCTGCGGATGTTCCAGAACGACCCGCAGACAGAAGCGATTGTTATGATCGGTGAAATCGGCGGCAGTGCGGAAGAAGAAGCGGCTGCCTTTATCAAAGACCACGTCACCAAACCTGTTGTGGCGTATATCGCGGGTGTGACCGCGCCGAAAGGCAAACGTATGGGTCATGCGGGGGCGATTATCGCAGGCGGGAAGGGGACAGCAGATGAGAAATTTGCCGCCCTTGAAGCCGCCGGTGTGAAGACGGTCCGCAGCCTGGCTGATATCGGTGATGCGGTAAAAGCGATTCTGAATAAATAATTCCTGCCATTATTATACAGCCGGAGCCGGTTCCATGCCGCTTCCGGCTG