Homologs in group_1407

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08375 FBDBKF_08375 100.0 Morganella morganii S1 dedA Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family
EHELCC_13150 EHELCC_13150 100.0 Morganella morganii S2 dedA Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family
NLDBIP_13490 NLDBIP_13490 100.0 Morganella morganii S4 dedA Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family
LHKJJB_13065 LHKJJB_13065 100.0 Morganella morganii S3 dedA Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family
F4V73_RS09575 F4V73_RS09575 86.4 Morganella psychrotolerans - VTT domain-containing protein
PMI_RS05140 PMI_RS05140 40.6 Proteus mirabilis HI4320 - VTT domain-containing protein

Distribution of the homologs in the orthogroup group_1407

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1407

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P57239 7.3e-06 48 28 0 96 3 BU139 Uncharacterized membrane protein BU139 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0A0H3H138 1.04e-05 47 23 4 164 1 dedA DedA family protein Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AA66 2.07e-05 46 27 2 137 3 yqjA Inner membrane protein YqjA Shigella flexneri
P0AA63 2.07e-05 46 27 2 137 1 yqjA Inner membrane protein YqjA Escherichia coli (strain K12)
P0AA64 2.07e-05 46 27 2 137 3 yqjA Inner membrane protein YqjA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA65 2.07e-05 46 27 2 137 3 yqjA Inner membrane protein YqjA Escherichia coli O157:H7
P0ABP6 5.66e-05 45 22 4 164 1 dedA Protein DedA Escherichia coli (strain K12)
P0ABP7 5.66e-05 45 22 4 164 3 dedA Protein DedA Escherichia coli O157:H7
Q8KA02 8.33e-05 45 26 0 96 3 BUsg_132 Uncharacterized membrane protein BUsg_132 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P30149 0.000196 43 25 0 98 1 yabI Inner membrane protein YabI Escherichia coli (strain K12)
Q89AV4 0.000224 43 28 2 101 3 bbp_130 Uncharacterized membrane protein bbp_130 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P0AA60 0.000348 43 25 2 140 1 yghB Inner membrane protein YghB Escherichia coli (strain K12)
P0AA61 0.000348 43 25 2 140 3 yghB Inner membrane protein YghB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA62 0.000348 43 25 2 140 3 yghB Inner membrane protein YghB Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11965
Feature type CDS
Gene dedA
Product Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family
Location 112449 - 112958 (strand: 1)
Length 510 (nucleotides) / 169 (amino acids)
In genomic island -

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1407
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09335 VTT domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0586 Cell wall/membrane/envelope biogenesis (M) M Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03975 membrane-associated protein - -

Protein Sequence

MDWITHHLAVLHDHPLWLLAILFVIALSKSTIILSSVLPPASVMLMTVVTLAFPVVPVVIIWLVITLGAACGSMISYYLGRLIITRNYFPGLMAKYKTALGKAQARLQTSGLLILFTSRFIAVLRYLIPMAAGLLRFTQTRVLVTCLLSAGVWTALYMLIAKGIEFTFF

Flanking regions ( +/- flanking 50bp)

TCCTGTGAGACAGCGCCGGATCTGCCGGCGCTGTCACCGGGAGGATAATTATGGACTGGATCACGCATCATCTGGCGGTACTGCACGACCACCCGCTCTGGCTGCTGGCCATTCTGTTTGTTATCGCCCTGAGCAAATCCACGATTATTCTCTCATCTGTCCTGCCGCCCGCCTCTGTCATGCTGATGACGGTAGTGACGCTGGCATTTCCGGTCGTTCCGGTGGTGATTATCTGGCTGGTGATTACGCTGGGTGCTGCCTGTGGTTCGATGATTTCGTATTATCTCGGCCGTCTGATTATCACCCGCAACTATTTTCCGGGGCTGATGGCGAAATACAAAACCGCCCTCGGTAAAGCCCAGGCACGGCTTCAGACCAGCGGGCTGCTGATCCTGTTTACCTCACGGTTTATTGCGGTGCTGCGCTATCTGATCCCGATGGCGGCCGGATTGCTGCGTTTCACACAGACCCGTGTGCTGGTGACCTGCCTGCTGTCCGCCGGGGTCTGGACCGCCCTTTACATGCTGATTGCAAAGGGCATTGAATTCACATTTTTCTGAGGTTGGATGTTACAGCCAATTCTTGCGTTTGAAGTAGAGATACGGCGCGA