Homologs in group_1457

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08645 FBDBKF_08645 100.0 Morganella morganii S1 secG preprotein translocase subunit SecG
EHELCC_12880 EHELCC_12880 100.0 Morganella morganii S2 secG preprotein translocase subunit SecG
NLDBIP_13220 NLDBIP_13220 100.0 Morganella morganii S4 secG preprotein translocase subunit SecG
LHKJJB_13335 LHKJJB_13335 100.0 Morganella morganii S3 secG preprotein translocase subunit SecG
F4V73_RS09870 F4V73_RS09870 90.2 Morganella psychrotolerans secG preprotein translocase subunit SecG
PMI_RS17000 PMI_RS17000 60.7 Proteus mirabilis HI4320 secG preprotein translocase subunit SecG

Distribution of the homologs in the orthogroup group_1457

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1457

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AG99 7.88e-54 166 74 1 112 1 secG Protein-export membrane protein SecG Escherichia coli (strain K12)
P0AGA0 7.88e-54 166 74 1 112 3 secG Protein-export membrane protein SecG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA1 7.88e-54 166 74 1 112 3 secG Protein-export membrane protein SecG Escherichia coli O157:H7
Q9HV52 1.09e-25 96 50 3 111 3 secG Protein-export membrane protein SecG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CP52 1.6e-25 95 52 3 116 3 secG Protein-export membrane protein SecG Pasteurella multocida (strain Pm70)
P44713 5.02e-23 89 57 3 114 3 secG Protein-export membrane protein SecG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P95577 3.12e-20 82 42 4 121 3 secG Protein-export membrane protein SecG Pseudomonas syringae pv. syringae (strain B728a)
P57460 2.37e-12 61 29 2 112 3 secG Protein-export membrane protein SecG Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O66505 3.36e-07 48 41 1 56 1 secG Protein-export membrane protein SecG Aquifex aeolicus (strain VF5)
Q7A1F4 6.79e-06 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain MW2)
Q6GB52 6.79e-06 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain MSSA476)
Q7A6Q1 6.79e-06 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain N315)
Q99VK3 6.79e-06 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHN9 6.79e-06 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain COL)
Q8CPY2 7.4e-06 43 40 2 69 3 secG Probable protein-export membrane protein SecG Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQU8 7.4e-06 43 40 2 69 3 secG Probable protein-export membrane protein SecG Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2G026 1.32e-05 43 35 2 76 3 SAOUHSC_00801 Protein translocase subunit SecG Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GIL2 1.56e-05 43 35 2 76 3 secG Probable protein-export membrane protein SecG Staphylococcus aureus (strain MRSA252)
Q4UNA3 5.94e-05 42 31 2 90 3 secG Protein-export membrane protein SecG Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O32233 9e-05 41 34 2 76 2 secG Probable protein-export membrane protein SecG Bacillus subtilis (strain 168)
Q49W06 0.000114 40 36 2 71 3 secG Probable protein-export membrane protein SecG Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L4K9 0.000457 39 34 2 69 3 secG Probable protein-export membrane protein SecG Staphylococcus haemolyticus (strain JCSC1435)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11695
Feature type CDS
Gene secG
Product preprotein translocase subunit SecG
Location 51809 - 52147 (strand: -1)
Length 339 (nucleotides) / 112 (amino acids)
In genomic island -

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1457
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03840 Preprotein translocase SecG subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1314 Intracellular trafficking, secretion, and vesicular transport (U) U Protein translocase subunit SecG

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03075 preprotein translocase subunit SecG Quorum sensing
Protein export
Bacterial secretion system
-

Protein Sequence

MYTALLVVFLLVAIALVGMILMQQGKGADMGASFGAGASATLFGSSGSGNFMTRTTGILATLFFVLSLVLGNMTSNKTGTGSKFDNLAQPVQTEQKTDVPAAPAAPNSDIPR

Flanking regions ( +/- flanking 50bp)

GATTGATACCGAATCAGTCGGTATACCGTACGAGGAATAGGTACACGTTTATGTATACAGCTCTCTTAGTCGTTTTCTTACTTGTTGCGATTGCCTTAGTCGGCATGATCTTAATGCAGCAGGGGAAAGGTGCGGACATGGGTGCTTCGTTCGGTGCAGGCGCGTCTGCAACACTGTTTGGTTCTTCGGGTTCAGGTAACTTCATGACCCGTACCACAGGCATTTTAGCAACACTGTTTTTTGTACTGAGTTTGGTTCTGGGCAACATGACCAGCAATAAAACCGGTACAGGCAGCAAGTTTGATAATCTCGCTCAGCCGGTGCAGACAGAACAGAAAACAGATGTTCCCGCAGCACCAGCAGCTCCTAACAGCGATATTCCGCGCTGATTGTTGCAAGTCTGAAGTAAAAGTTTTAAACGGGATTGATACACACCATC