Homologs in group_957

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05250 FBDBKF_05250 100.0 Morganella morganii S1 yciY YciY family protein
EHELCC_12340 EHELCC_12340 100.0 Morganella morganii S2 yciY YciY family protein
NLDBIP_12680 NLDBIP_12680 100.0 Morganella morganii S4 yciY YciY family protein
LHKJJB_12540 LHKJJB_12540 100.0 Morganella morganii S3 yciY YciY family protein
F4V73_RS05705 F4V73_RS05705 86.4 Morganella psychrotolerans - YciY family protein
PMI_RS06545 PMI_RS06545 72.4 Proteus mirabilis HI4320 - YciY family protein

Distribution of the homologs in the orthogroup group_957

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_957

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1RCI6 3.71e-16 67 64 0 53 3 yciY Uncharacterized protein YciY Escherichia coli (strain UTI89 / UPEC)
A5A613 3.71e-16 67 64 0 53 3 yciY Uncharacterized protein YciY Escherichia coli (strain K12)
Q8FHW7 3.71e-16 67 64 0 53 3 yciY Uncharacterized protein YciY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIC1 3.71e-16 67 64 0 53 3 yciY Uncharacterized protein YciY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AAH4 3.71e-16 67 64 0 53 3 yciY Uncharacterized protein YciY Escherichia coli O1:K1 / APEC

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11155
Feature type CDS
Gene yciY
Product YciY family protein
Location 124922 - 125101 (strand: 1)
Length 180 (nucleotides) / 59 (amino acids)

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_957
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Protein Sequence

MRHSRPEVARWRMLRQATRRRRRWLESQSRRNIRIFALRKLDIARQRRSLLFAQAELSH

Flanking regions ( +/- flanking 50bp)

GCCCTTATTATTAGCTTATTTTTTCACACAGTCTAAAAAAGGGTTTAGTTATGAGACACAGCAGACCGGAAGTTGCACGTTGGCGTATGTTACGGCAGGCAACCCGTCGTCGTCGTCGCTGGCTGGAAAGTCAGTCCCGGCGGAACATCCGGATTTTTGCTCTGCGCAAGCTGGATATCGCGAGACAACGCCGTTCGCTGCTGTTTGCTCAGGCTGAATTAAGCCACTAAGAAGTGACCATCAGCACGATAAGTGACAATGGTTGTGTCTTTCGTATTGA