Homologs in group_415

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05290 FBDBKF_05290 100.0 Morganella morganii S1 oppB oligopeptide ABC transporter permease OppB
EHELCC_12300 EHELCC_12300 100.0 Morganella morganii S2 oppB oligopeptide ABC transporter permease OppB
NLDBIP_12640 NLDBIP_12640 100.0 Morganella morganii S4 oppB oligopeptide ABC transporter permease OppB
LHKJJB_12500 LHKJJB_12500 100.0 Morganella morganii S3 oppB oligopeptide ABC transporter permease OppB
F4V73_RS05745 F4V73_RS05745 96.7 Morganella psychrotolerans oppB oligopeptide ABC transporter permease OppB
PMI_RS07135 PMI_RS07135 86.6 Proteus mirabilis HI4320 oppB oligopeptide ABC transporter permease OppB

Distribution of the homologs in the orthogroup group_415

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_415

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFH5 0.0 542 87 0 306 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 0.0 542 87 0 306 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 0.0 542 87 0 306 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 0.0 542 87 0 306 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
P08005 0.0 540 85 0 306 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45054 4.56e-173 484 74 0 306 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24138 2.1e-94 285 50 1 305 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P26903 9.42e-81 249 41 1 305 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
P42062 4.29e-68 218 36 4 319 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
A2RI75 2.6e-63 205 37 4 283 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
Q2YJK1 3.53e-61 200 37 3 314 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 3.53e-61 200 37 3 314 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8YDG7 3.84e-61 199 37 3 314 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUX0 2.76e-60 197 36 3 314 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
A0A0H2ZGW7 1.83e-59 196 34 4 335 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8Z862 2.1e-58 192 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 2.1e-58 192 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q8ZQM2 2.52e-58 192 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP5 2.68e-58 192 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z3V2 2.26e-57 189 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q32IB7 2.49e-57 189 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 2.49e-57 189 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 2.49e-57 189 35 3 308 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 2.49e-57 189 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 2.49e-57 189 35 3 308 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q8FWN8 5.43e-57 189 33 3 319 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
Q0T6D1 9.34e-57 188 34 3 308 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q8X6V7 1.29e-56 187 34 3 308 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q8YBN9 1.56e-56 188 33 3 319 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 1.56e-56 188 33 3 319 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q83S26 1.74e-56 187 34 3 308 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
P45096 1.94e-56 188 34 5 335 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FJK9 2e-56 187 34 3 308 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q323W3 4.35e-56 186 34 3 308 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
P0AEF8 4.47e-56 187 33 4 338 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 4.47e-56 187 33 4 338 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 4.47e-56 187 33 4 338 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
Q53191 8.7e-55 183 34 4 311 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P33591 3.89e-54 181 34 3 310 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
P94311 4.28e-52 177 33 5 335 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q6D3B1 3.12e-51 174 33 3 308 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9CKL3 4.88e-43 154 28 6 360 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P0AFU0 6.98e-43 154 27 4 362 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 6.98e-43 154 27 4 362 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P0A4N8 1.39e-41 149 32 4 319 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 1.39e-41 149 32 4 319 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
Q2FVE8 3.04e-41 148 30 4 311 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3K104 9.74e-41 147 29 4 311 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG38 3.17e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 3.17e-40 145 28 5 311 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 3.17e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q2YXY7 3.27e-40 145 29 5 312 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NWT4 4.04e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 4.04e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
Q7A5Q6 4.21e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 4.21e-40 145 28 5 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GH25 1.84e-39 144 27 3 310 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
P66967 1.53e-38 141 30 7 328 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 1.53e-38 141 30 7 328 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 1.53e-38 141 30 7 328 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P77308 1.72e-32 125 31 6 313 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
P0AGH3 4.52e-30 119 30 4 271 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 4.52e-30 119 30 4 271 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
P47323 3.4e-26 110 25 7 318 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75554 7.84e-26 108 25 3 298 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P0A2J3 3.42e-24 103 29 5 259 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 3.42e-24 103 29 5 259 3 sapB Peptide transport system permease protein SapB Salmonella typhi
P45286 3.02e-20 92 24 4 274 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4M8 2.87e-17 85 27 5 243 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 2.87e-17 85 27 5 243 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8YDG8 0.000285 45 26 8 220 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 0.000285 45 26 8 220 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 0.000285 45 26 8 220 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q8FUW9 0.00032 45 26 8 220 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11115
Feature type CDS
Gene oppB
Product oligopeptide ABC transporter permease OppB
Location 117914 - 118834 (strand: 1)
Length 921 (nucleotides) / 306 (amino acids)
In genomic island -

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_415
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF19300 Binding-prot-dependent transport system membrane comp, N-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15581 oligopeptide transport system permease protein beta-Lactam resistance
ABC transporters
Quorum sensing
-

Protein Sequence

MFKFILRRILEAIPTLFVLITISFFMMRLAPGSPFTGERKLPPEVMANIEAKYHLNDPIHVQYFDYLVQLSKGDFGPSFKYKDYSVNDLVASAFPVSAKLGLAAFVLALIVGVSAGVIAALNQNTKWDYTVMGFAMTGVVIPSFVVAPLLVLIFAIHLHWLPGGGWNGGQLSNIILPMIALSLAYIASISRIMRSSMIEVMHSNFIRTARAKGLPMRKIVWQHALRPALLPVVSYMGPAFVGIITGSMVIETIFGLPGVGQLFVNGALNRDYSLVLSLTILVGTLTIAFNCIVDVLYAVIDPKIRY

Flanking regions ( +/- flanking 50bp)

GGCCTGTGTAGTGTGTACCCCGGGAAGCGGGTACTGTATAGGAACGGGCAATGTTTAAGTTTATTCTTCGCCGTATACTCGAGGCGATCCCGACGCTTTTTGTGTTAATTACTATCTCTTTCTTTATGATGCGTCTGGCTCCGGGCAGTCCATTTACCGGTGAGCGTAAATTGCCGCCGGAAGTGATGGCGAATATTGAAGCCAAGTACCATCTTAATGATCCGATTCACGTTCAGTATTTTGATTATTTAGTTCAGTTATCAAAGGGGGACTTCGGGCCTTCCTTTAAATATAAAGATTACTCGGTGAATGACCTGGTCGCCTCCGCGTTTCCGGTCTCCGCAAAACTCGGGCTGGCGGCGTTTGTGCTGGCACTGATTGTCGGGGTGAGTGCCGGTGTGATAGCGGCACTGAATCAGAATACCAAATGGGACTATACCGTCATGGGCTTTGCCATGACCGGGGTGGTTATCCCCAGCTTTGTGGTGGCGCCGCTGCTGGTACTTATCTTTGCCATCCATCTGCACTGGCTGCCGGGCGGCGGCTGGAACGGCGGGCAGCTCAGCAATATCATTCTGCCGATGATTGCGCTGTCACTGGCCTATATCGCCAGTATCTCCCGTATTATGCGCAGCTCCATGATTGAGGTGATGCACTCCAACTTTATCCGTACCGCACGGGCGAAAGGTCTGCCGATGCGTAAGATTGTCTGGCAGCATGCACTGCGCCCGGCACTGTTACCGGTGGTCTCTTATATGGGACCGGCATTTGTGGGGATTATCACGGGTTCAATGGTGATTGAGACGATTTTCGGTTTACCGGGCGTGGGGCAGTTATTTGTCAACGGCGCGCTGAACCGCGATTACTCTCTGGTGCTGAGTCTGACCATCCTGGTCGGCACACTGACCATCGCCTTTAACTGTATCGTTGACGTGCTGTATGCCGTTATCGATCCGAAAATCCGTTATTAGTCCCGGAGCACGCTATGTTACCGAATGAAAAAAACCGCGAAGCTCTGGAA