Homologs in group_485

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13840 FBDBKF_13840 100.0 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11510 EHELCC_11510 100.0 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11855 NLDBIP_11855 100.0 Morganella morganii S4 terZ Stress response protein SCP2
LHKJJB_11715 LHKJJB_11715 100.0 Morganella morganii S3 terZ Stress response protein SCP2
F4V73_RS12705 F4V73_RS12705 94.2 Morganella psychrotolerans - TerD family protein
PMI_RS11790 PMI_RS11790 84.3 Proteus mirabilis HI4320 - TerD family protein

Distribution of the homologs in the orthogroup group_485

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_485

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52358 2.31e-125 353 89 0 191 3 terE Tellurium resistance protein TerE Serratia marcescens
P18782 2.89e-120 341 83 0 191 3 terE Tellurium resistance protein TerE Alcaligenes sp.
Q52357 3.76e-94 275 66 0 190 3 terD Tellurium resistance protein TerD Serratia marcescens
P18781 5.48e-91 267 64 0 190 3 terD Tellurium resistance protein TerD Alcaligenes sp.
O34384 1.86e-70 215 51 1 192 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q45812 3.28e-70 214 53 1 192 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
P80875 1.93e-68 209 51 1 192 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
P34122 3.93e-59 189 49 1 191 1 capB cAMP-binding protein 2 Dictyostelium discoideum
P19198 1.03e-55 182 47 1 184 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
P81100 8.3e-51 165 44 2 186 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
Q45811 1.08e-40 137 50 0 138 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P75012 6.72e-37 130 39 4 199 3 terX Tellurium resistance protein TerX Serratia marcescens
Q52353 1.43e-31 115 38 5 185 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P73042 4.09e-24 96 34 6 183 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18778 4.06e-08 55 32 3 107 4 terA Tellurium resistance protein TerA Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10325
Feature type CDS
Gene terZ
Product Stress response protein SCP2
Location 148262 - 148837 (strand: -1)
Length 576 (nucleotides) / 191 (amino acids)
In genomic island -

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_485
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05795 tellurium resistance protein TerD - -

Protein Sequence

MAVSLTKGGNVSLTKEAPSMSVAMVGLGWDARVTDGQDFDLDASVFMVGDDGKVLSDSHFIFFNNKTSPCGAVEHQGDNRTGEGDGDDEQVKISLTTLPVDVKKLVFSVTIYDAEARKQNFGMVSNSFIRICNNDNGSEIARFDLSEDASTETAMVFGELYRHGTEWKFKAVGQGFAGGLSALASQHGVNI

Flanking regions ( +/- flanking 50bp)

CAGCGGGCTGACAACCAGCCCTCTTTATAACCCGCAGCAGGAGTCCGAAAATGGCAGTTTCTCTTACAAAAGGCGGTAACGTATCCCTGACCAAAGAAGCCCCGTCAATGAGCGTGGCGATGGTTGGTCTCGGCTGGGATGCGCGTGTGACTGATGGTCAGGATTTTGACCTCGACGCATCTGTATTTATGGTGGGTGACGACGGAAAAGTATTATCCGACAGCCATTTCATCTTCTTTAATAACAAAACCAGCCCGTGCGGCGCGGTGGAACACCAGGGCGACAACCGCACCGGTGAAGGCGACGGTGATGATGAGCAGGTTAAAATCAGCCTGACTACCCTTCCGGTGGATGTGAAAAAACTGGTCTTCTCCGTCACGATTTATGATGCGGAAGCACGTAAACAGAACTTTGGTATGGTCAGCAACAGCTTCATCCGTATCTGTAACAATGATAACGGCAGTGAAATTGCCCGTTTCGACCTGTCTGAAGATGCATCAACAGAAACCGCGATGGTCTTCGGTGAGTTGTACCGTCACGGAACAGAGTGGAAATTCAAAGCCGTCGGCCAGGGCTTCGCCGGTGGTCTGTCTGCATTAGCGTCTCAGCACGGTGTTAATATTTAATTATTGATATCAGCTGGTTGCCGTAAAAAATGCCCTGTCCGTGACGGACA