Homologs in group_54

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13845 FBDBKF_13845 63.4 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11510 EHELCC_11510 100.0 Morganella morganii S2 terZ Stress response protein SCP2
EHELCC_11515 EHELCC_11515 63.4 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11855 NLDBIP_11855 100.0 Morganella morganii S4 terZ Stress response protein SCP2
NLDBIP_11860 NLDBIP_11860 63.4 Morganella morganii S4 terZ Stress response protein SCP2
LHKJJB_11715 LHKJJB_11715 100.0 Morganella morganii S3 terZ Stress response protein SCP2
LHKJJB_11720 LHKJJB_11720 63.4 Morganella morganii S3 terZ Stress response protein SCP2
HKOGLL_10325 HKOGLL_10325 100.0 Morganella morganii S5 terZ Stress response protein SCP2
HKOGLL_10330 HKOGLL_10330 63.4 Morganella morganii S5 terZ Stress response protein SCP2
F4V73_RS12705 F4V73_RS12705 94.2 Morganella psychrotolerans - TerD family protein
F4V73_RS12710 F4V73_RS12710 61.8 Morganella psychrotolerans - TerD family protein
PMI_RS11790 PMI_RS11790 84.3 Proteus mirabilis HI4320 - TerD family protein
PMI_RS11795 PMI_RS11795 65.4 Proteus mirabilis HI4320 terD tellurium resistance membrane protein TerD

Distribution of the homologs in the orthogroup group_54

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_54

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52358 2.31e-125 353 89 0 191 3 terE Tellurium resistance protein TerE Serratia marcescens
P18782 2.89e-120 341 83 0 191 3 terE Tellurium resistance protein TerE Alcaligenes sp.
Q52357 3.76e-94 275 66 0 190 3 terD Tellurium resistance protein TerD Serratia marcescens
P18781 5.48e-91 267 64 0 190 3 terD Tellurium resistance protein TerD Alcaligenes sp.
O34384 1.86e-70 215 51 1 192 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q45812 3.28e-70 214 53 1 192 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
P80875 1.93e-68 209 51 1 192 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
P34122 3.93e-59 189 49 1 191 1 capB cAMP-binding protein 2 Dictyostelium discoideum
P19198 1.03e-55 182 47 1 184 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
P81100 8.3e-51 165 44 2 186 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
Q45811 1.08e-40 137 50 0 138 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P75012 6.72e-37 130 39 4 199 3 terX Tellurium resistance protein TerX Serratia marcescens
Q52353 1.43e-31 115 38 5 185 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P73042 4.09e-24 96 34 6 183 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18778 4.06e-08 55 32 3 107 4 terA Tellurium resistance protein TerA Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13840
Feature type CDS
Gene terZ
Product Stress response protein SCP2
Location 63386 - 63961 (strand: -1)
Length 576 (nucleotides) / 191 (amino acids)

Contig

Accession contig_17
Length 103646 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_54
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05795 tellurium resistance protein TerD - -

Protein Sequence

MAVSLTKGGNVSLTKEAPSMSVAMVGLGWDARVTDGQDFDLDASVFMVGDDGKVLSDSHFIFFNNKTSPCGAVEHQGDNRTGEGDGDDEQVKISLTTLPVDVKKLVFSVTIYDAEARKQNFGMVSNSFIRICNNDNGSEIARFDLSEDASTETAMVFGELYRHGTEWKFKAVGQGFAGGLSALASQHGVNI

Flanking regions ( +/- flanking 50bp)

CAGCGGGCTGACAACCAGCCCTCTTTATAACCCGCAGCAGGAGTCCGAAAATGGCAGTTTCTCTTACAAAAGGCGGTAACGTATCCCTGACCAAAGAAGCCCCGTCAATGAGCGTGGCGATGGTTGGTCTCGGCTGGGATGCGCGTGTGACTGATGGTCAGGATTTTGACCTCGACGCATCTGTATTTATGGTGGGTGACGACGGAAAAGTATTATCCGACAGCCATTTCATCTTCTTTAATAACAAAACCAGCCCGTGCGGCGCGGTGGAACACCAGGGCGACAACCGCACCGGTGAAGGCGACGGTGATGATGAGCAGGTTAAAATCAGCCTGACTACCCTTCCGGTGGATGTGAAAAAACTGGTCTTCTCCGTCACGATTTATGATGCGGAAGCACGTAAACAGAACTTTGGTATGGTCAGCAACAGCTTCATCCGTATCTGTAACAATGATAACGGCAGTGAAATTGCCCGTTTCGACCTGTCTGAAGATGCATCAACAGAAACCGCGATGGTCTTCGGTGAGTTGTACCGTCACGGAACAGAGTGGAAATTCAAAGCCGTCGGCCAGGGCTTCGCCGGTGGTCTGTCTGCATTAGCGTCTCAGCACGGTGTTAATATTTAATTATTGATATCAGCTGGTTGCCGTAAAAAATGCCCTGTCCGTGACGGACA