Homologs in group_3125

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20010 FBDBKF_20010 100.0 Morganella morganii S1 fimA type 1 fimbrial major subunit FimA
EHELCC_03520 EHELCC_03520 100.0 Morganella morganii S2 fimA type 1 fimbrial major subunit FimA
NLDBIP_03520 NLDBIP_03520 100.0 Morganella morganii S4 fimA type 1 fimbrial major subunit FimA
LHKJJB_09350 LHKJJB_09350 100.0 Morganella morganii S3 fimA type 1 fimbrial major subunit FimA
PMI_RS07110 PMI_RS07110 60.8 Proteus mirabilis HI4320 fimA type 1 fimbrial major subunit FimA

Distribution of the homologs in the orthogroup group_3125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37921 8.71e-51 164 47 2 186 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 1.35e-49 161 51 1 159 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37920 9.25e-46 151 46 3 186 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P0ABW5 2.32e-43 145 49 1 161 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 2.32e-43 145 49 1 161 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P62605 8.01e-42 141 48 5 185 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 8.01e-42 141 48 5 185 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12730 1.67e-39 135 45 4 185 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q47223 7.36e-39 134 46 3 185 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12903 9.47e-38 131 44 3 187 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P12266 4.97e-37 129 48 2 160 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P43660 1.53e-35 125 41 3 182 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04128 8.51e-35 124 47 3 161 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q8X5K5 1.15e-34 123 43 3 182 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P39264 7.73e-25 98 32 4 187 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
Q08456 4.34e-23 93 33 3 158 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P37922 1.03e-21 90 32 3 158 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P22595 1.03e-20 87 39 4 160 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
Q03011 2.24e-18 81 37 8 191 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P13421 1.47e-17 79 38 5 158 1 smfA Fimbria A protein Serratia marcescens
P77789 1.33e-15 73 33 5 157 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P08189 3.6e-14 70 32 5 158 1 fimF Protein FimF Escherichia coli (strain K12)
P42184 5.37e-14 69 35 6 163 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P37926 1.18e-13 68 30 4 178 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q04681 1.9e-13 68 32 6 162 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P62607 2.13e-13 68 30 4 195 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 2.13e-13 68 30 4 195 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43664 1.76e-12 65 30 4 176 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X582 1.05e-11 63 28 7 189 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P04740 2.02e-11 63 29 6 194 3 KS71A KS71A fimbrillin Escherichia coli
P45992 5.78e-11 62 31 7 195 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P75855 8.88e-11 61 27 7 189 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P75859 2.37e-10 60 31 3 154 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P42913 3.85e-10 59 30 7 173 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P37909 3.87e-10 59 29 9 192 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P39834 4.73e-10 59 30 4 159 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P38052 8.16e-10 58 28 3 157 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P04127 5.16e-09 56 32 8 194 1 papA Pap fimbrial major pilin protein Escherichia coli
P13429 7.72e-09 55 25 4 185 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P53521 1.54e-08 55 27 8 189 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P45993 2.15e-07 52 35 4 114 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P45988 6.16e-07 51 28 4 177 3 hifA Major fimbrial subunit Haemophilus influenzae
Q8X5L0 6.36e-07 50 27 3 183 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7
P75860 3.56e-06 48 30 6 155 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P62532 5.32e-06 48 27 6 166 1 papK Fimbrial adapter PapK Escherichia coli
P62533 5.32e-06 48 27 6 166 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q03846 9.18e-06 47 27 2 135 3 hifA Major fimbrial subunit Haemophilus influenzae
P21413 1.04e-05 47 28 5 139 3 fasA Fimbrial protein 987P Escherichia coli
P45990 1.45e-05 47 28 2 131 3 hifA Major fimbrial subunit Haemophilus influenzae
P11312 2.42e-05 46 27 6 161 3 F17a-A F17 fimbrial protein Escherichia coli
P76499 0.000177 43 27 10 185 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P42191 0.000664 42 27 6 161 1 prsK Protein PrsK Escherichia coli
P75917 0.000731 40 36 0 55 2 ymdA Uncharacterized protein YmdA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_09625
Feature type CDS
Gene fimA
Product type 1 fimbrial major subunit FimA
Location 177365 - 177925 (strand: 1)
Length 561 (nucleotides) / 186 (amino acids)

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3125
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MLNKQRLVMSVVALAVLSASQLSMAATTVTGGTVHFTGRIVNAACAVSADSTDQTVNMGQYRTAFFNAKGKKSGDVPFSIKLEDCDTSVSTKASVSFSGLSSADDPTALQTSNIGGGSAGAAKGVGIQIADHLGKVVKPDGSVFSTAQNLVDGVNVLNFSANYISTQATVTPGGADADATFTMQYQ

Flanking regions ( +/- flanking 50bp)

AATAATAATATTTTAACATCAAATAAAATTAACAATGAGGATTAAAGCGTATGTTGAATAAACAACGTTTAGTTATGTCTGTGGTTGCTCTCGCCGTATTATCCGCAAGTCAGTTAAGTATGGCTGCAACAACTGTTACCGGTGGTACCGTTCACTTTACCGGACGAATTGTGAATGCCGCGTGTGCTGTCAGCGCTGACTCTACTGATCAGACGGTCAATATGGGGCAGTACCGCACTGCATTCTTTAATGCCAAAGGGAAAAAATCCGGTGATGTACCGTTTTCTATTAAATTAGAAGACTGTGATACCAGTGTATCCACCAAGGCGTCTGTTTCATTCTCCGGATTATCTTCCGCAGATGACCCGACTGCATTGCAGACCAGTAATATCGGCGGCGGTTCAGCCGGTGCGGCGAAAGGTGTCGGTATTCAGATTGCTGATCACCTGGGGAAAGTGGTGAAACCGGATGGTTCTGTTTTTTCAACCGCACAAAACTTAGTGGATGGCGTCAACGTTCTGAATTTTTCCGCAAATTATATTTCAACTCAAGCCACGGTAACACCGGGCGGCGCGGACGCGGATGCCACTTTTACAATGCAGTATCAATAAAGTCGCCTTTTATTGCTGAACCCGTTAGCGCGTTATCAGTGGCCCGGGTG