Homologs in group_2451

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20555 FBDBKF_20555 100.0 Morganella morganii S1 - helix-turn-helix transcriptional regulator
EHELCC_04300 EHELCC_04300 100.0 Morganella morganii S2 - helix-turn-helix transcriptional regulator
NLDBIP_04300 NLDBIP_04300 100.0 Morganella morganii S4 - helix-turn-helix transcriptional regulator
LHKJJB_10130 LHKJJB_10130 100.0 Morganella morganii S3 - helix-turn-helix transcriptional regulator
PMI_RS04680 PMI_RS04680 52.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS04685 PMI_RS04685 50.0 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2451

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2451

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P23789 3.93e-05 42 31 3 79 1 xre HTH-type transcriptional regulator Xre Bacillus subtilis (strain 168)
P0C5S2 6.93e-05 42 30 1 66 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 6.93e-05 42 30 1 66 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
O85264 0.000301 39 28 1 69 4 rstR Cryptic phage CTXphi transcriptional repressor RstR Vibrio cholerae

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_08845
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 3051 - 3314 (strand: -1)
Length 264 (nucleotides) / 87 (amino acids)

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2451
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MITKRLKEARLRAGLSQEKLGILAGIDEASASARMNQYEKGKHTPDFNTVEKFAKVLDIPVPYFYTDDDLLAEIIINYKKIAEKDKK

Flanking regions ( +/- flanking 50bp)

ATACAGAAACCTAAGAAAATCTTAGTCAAATCATCTTGACTGAGGTTGTTATGATCACAAAAAGACTAAAAGAAGCTCGATTAAGAGCTGGTCTGTCACAAGAAAAACTTGGTATTTTAGCTGGTATTGATGAGGCATCTGCTAGCGCGCGTATGAACCAATACGAGAAAGGTAAACATACACCAGATTTCAATACAGTAGAAAAATTTGCTAAAGTACTTGATATACCTGTACCATATTTTTATACCGACGACGACTTACTTGCTGAAATCATTATTAATTACAAAAAAATAGCAGAAAAAGACAAAAAATAACTGATTTGTAGAATAAAAAAATAATTTAAACATTAATTCTTAATTTTATA