Homologs in group_2477

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20555 FBDBKF_20555 52.9 Morganella morganii S1 - helix-turn-helix transcriptional regulator
EHELCC_04300 EHELCC_04300 52.9 Morganella morganii S2 - helix-turn-helix transcriptional regulator
NLDBIP_04300 NLDBIP_04300 52.9 Morganella morganii S4 - helix-turn-helix transcriptional regulator
LHKJJB_10130 LHKJJB_10130 52.9 Morganella morganii S3 - helix-turn-helix transcriptional regulator
HKOGLL_08845 HKOGLL_08845 52.9 Morganella morganii S5 - helix-turn-helix transcriptional regulator
PMI_RS04685 PMI_RS04685 54.1 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2477

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2477

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04680
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 1033629 - 1033889 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)
In genomic island GI56

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2477
Orthogroup size 7
N. genomes 6

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MVPKRLKAARARVALTQEELGILAGIDEESAKIRVCQYESGTHRPNFETICRFSKILKVPENYFYTLNDEFAEELINIYNNKYNCS

Flanking regions ( +/- flanking 50bp)

TAATTTTTATGATATAAACTTATGCAGTCATCTTAAATGTTAGAGTTATTATGGTACCTAAAAGATTAAAGGCTGCAAGGGCAAGAGTTGCATTAACTCAAGAAGAGTTAGGTATTTTAGCTGGGATTGATGAAGAATCAGCTAAAATTAGAGTGTGTCAATATGAGTCTGGTACACACCGCCCAAACTTTGAAACTATTTGCCGATTTTCCAAAATATTAAAAGTTCCAGAAAATTATTTTTATACTTTAAATGATGAATTCGCGGAAGAGTTAATAAATATTTATAATAATAAATATAATTGCTCTTAAATATTATTTAGAAAGATTATACATGTTTTGTTACTTTGTTATATAAAGTA