Homologs in group_182

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06485 FBDBKF_06485 100.0 Morganella morganii S1 dnaJ molecular chaperone DnaJ
EHELCC_09530 EHELCC_09530 100.0 Morganella morganii S2 dnaJ molecular chaperone DnaJ
NLDBIP_09910 NLDBIP_09910 100.0 Morganella morganii S4 dnaJ molecular chaperone DnaJ
LHKJJB_07845 LHKJJB_07845 100.0 Morganella morganii S3 dnaJ molecular chaperone DnaJ
F4V73_RS15445 F4V73_RS15445 95.3 Morganella psychrotolerans dnaJ molecular chaperone DnaJ
PMI_RS00050 PMI_RS00050 82.5 Proteus mirabilis HI4320 dnaJ molecular chaperone DnaJ
PMI_RS03925 PMI_RS03925 39.3 Proteus mirabilis HI4320 cbpA curved DNA-binding protein
PMI_RS18735 PMI_RS18735 32.5 Proteus mirabilis HI4320 - J domain-containing protein

Distribution of the homologs in the orthogroup group_182

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_182

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2V6 0.0 624 81 1 381 3 dnaJ Chaperone protein DnaJ Proteus mirabilis (strain HI4320)
A6T4F5 0.0 620 82 1 381 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y241 0.0 620 81 1 381 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae (strain 342)
B2VGS0 0.0 619 81 1 381 3 dnaJ Chaperone protein DnaJ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5YYA8 0.0 618 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q3Z600 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Shigella sonnei (strain Ss046)
B7LVP7 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGI7 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain UTI89 / UPEC)
B1LFU5 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ11 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SE11)
B7N7N9 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IRF9 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FLC5 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVV8 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O9:H4 (strain HS)
B7M0B1 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O8 (strain IAI1)
B7MNM2 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O81 (strain ED1a)
B7NHB7 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8XA65 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7
B7L4D9 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain 55989 / EAEC)
B7MAD6 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI60 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHA5 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q326K6 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 4 (strain Sb227)
B2U233 0.0 617 80 1 381 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0T8H5 0.0 616 80 1 381 3 dnaJ Chaperone protein DnaJ Shigella flexneri serotype 5b (strain 8401)
Q32KA4 0.0 615 80 1 381 3 dnaJ Chaperone protein DnaJ Shigella dysenteriae serotype 1 (strain Sd197)
A9MR76 0.0 615 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7N8Y3 0.0 615 80 1 381 3 dnaJ Chaperone protein DnaJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P08622 0.0 615 80 1 381 1 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12)
B1XBE0 0.0 615 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / DH10B)
B5BLH9 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain AKU_12601)
Q5PDJ4 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0A1G7 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1G8 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella typhi
B4TVZ6 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella schwarzengrund (strain CVM19633)
C0Q4F4 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi C (strain RKS4594)
A9MXI3 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T6D7 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella newport (strain SL254)
B4TIB5 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella heidelberg (strain SL476)
B5RF09 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5I3 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella enteritidis PT4 (strain P125109)
B5FHA7 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella dublin (strain CT_02021853)
Q57TP2 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella choleraesuis (strain SC-B67)
B5F6Y9 0.0 614 80 1 381 3 dnaJ Chaperone protein DnaJ Salmonella agona (strain SL483)
C4ZPU1 0.0 613 80 1 381 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / MC4100 / BW2952)
B1JL03 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66ES9 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQF8 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pestis (strain Pestoides F)
Q1CMV6 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R014 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIM6 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pestis
B2K3M1 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0J8 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FME2 0.0 611 80 1 381 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5B7L8 0.0 610 80 2 381 3 dnaJ Chaperone protein DnaJ Edwardsiella ictaluri (strain 93-146)
A4W6D6 0.0 609 80 1 382 3 dnaJ Chaperone protein DnaJ Enterobacter sp. (strain 638)
Q7UDU1 0.0 608 79 1 381 3 dnaJ Chaperone protein DnaJ Shigella flexneri
C6DF09 0.0 601 79 2 381 3 dnaJ Chaperone protein DnaJ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0B8 0.0 600 79 2 381 3 dnaJ Chaperone protein DnaJ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9K9 0.0 599 79 3 381 3 dnaJ Chaperone protein DnaJ Serratia proteamaculans (strain 568)
A1JJD6 0.0 592 78 2 381 3 dnaJ Chaperone protein DnaJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NVZ0 0.0 589 77 2 381 3 dnaJ Chaperone protein DnaJ Sodalis glossinidius (strain morsitans)
A7MIK3 0.0 580 78 2 381 3 dnaJ Chaperone protein DnaJ Cronobacter sakazakii (strain ATCC BAA-894)
Q493S6 0.0 565 69 2 381 3 dnaJ Chaperone protein DnaJ Blochmanniella pennsylvanica (strain BPEN)
C4L8Y4 0.0 553 71 1 380 3 dnaJ Chaperone protein DnaJ Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8D757 0.0 548 67 2 381 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
O32465 0.0 548 67 2 381 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8V3 0.0 548 67 2 381 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A8FYT9 0.0 547 72 2 383 3 dnaJ Chaperone protein DnaJ Shewanella sediminis (strain HAW-EB3)
A8H759 0.0 539 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KRT1 0.0 537 71 2 383 3 dnaJ Chaperone protein DnaJ Shewanella woodyi (strain ATCC 51908 / MS32)
Q6LUA6 0.0 534 71 3 384 3 dnaJ Chaperone protein DnaJ Photobacterium profundum (strain SS9)
Q7MN84 0.0 533 73 2 383 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain YJ016)
Q8DF67 0.0 533 73 2 383 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain CMCP6)
Q87RX2 0.0 533 73 2 383 3 dnaJ Chaperone protein DnaJ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8CKF4 0.0 532 70 3 383 3 dnaJ Chaperone protein DnaJ Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8K9Y9 0.0 530 65 2 381 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C3LTA6 0.0 528 71 2 382 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain M66-2)
O34242 0.0 528 71 2 382 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F362 0.0 528 71 2 382 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5E3A8 0.0 527 71 1 381 3 dnaJ Chaperone protein DnaJ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q15UD2 0.0 527 70 3 384 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B6EKA0 0.0 525 71 2 383 3 dnaJ Chaperone protein DnaJ Aliivibrio salmonicida (strain LFI1238)
A6WRU8 0.0 524 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS185)
A3D7T3 0.0 524 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4S2 0.0 524 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS223)
Q8D2Q6 0.0 523 64 2 380 3 dnaJ Chaperone protein DnaJ Wigglesworthia glossinidia brevipalpis
Q9CMS2 0.0 523 69 2 381 3 dnaJ Chaperone protein DnaJ Pasteurella multocida (strain Pm70)
A9L0R7 0.0 523 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS195)
A7MWW1 0.0 522 72 2 383 3 dnaJ Chaperone protein DnaJ Vibrio campbellii (strain ATCC BAA-1116)
Q8EHT6 0.0 522 71 3 383 3 dnaJ Chaperone protein DnaJ Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TQC1 0.0 522 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella halifaxensis (strain HAW-EB4)
Q89AU7 0.0 522 63 2 383 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0HY10 0.0 521 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-7)
Q0HLM9 0.0 521 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-4)
A3QGW1 0.0 521 71 3 382 3 dnaJ Chaperone protein DnaJ Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A0KTS6 0.0 520 70 3 382 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain ANA-3)
Q086J2 0.0 519 70 3 383 3 dnaJ Chaperone protein DnaJ Shewanella frigidimarina (strain NCIMB 400)
A1RGN2 0.0 518 70 3 382 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain W3-18-1)
Q7VQL3 0.0 518 68 3 382 3 dnaJ Chaperone protein DnaJ Blochmanniella floridana
A4Y9Q2 0.0 516 70 3 382 3 dnaJ Chaperone protein DnaJ Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B7VJX0 0.0 514 72 2 384 3 dnaJ Chaperone protein DnaJ Vibrio atlanticus (strain LGP32)
Q65U54 0.0 513 69 2 381 3 dnaJ Chaperone protein DnaJ Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1S8K6 0.0 510 69 3 382 3 dnaJ Chaperone protein DnaJ Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KMI5 1.01e-180 509 72 2 382 3 dnaJ Chaperone protein DnaJ Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5QXL2 1.05e-180 509 68 3 382 3 dnaJ Chaperone protein DnaJ Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q4QJW5 1.41e-179 506 67 1 381 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain 86-028NP)
Q12Q07 1.95e-178 503 70 3 383 3 dnaJ Chaperone protein DnaJ Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3IC07 2.18e-177 501 70 3 383 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas translucida (strain TAC 125)
O87385 4.65e-177 500 70 4 387 3 dnaJ Chaperone protein DnaJ Vibrio harveyi
Q1IF58 6.21e-177 499 67 3 382 3 dnaJ Chaperone protein DnaJ Pseudomonas entomophila (strain L48)
Q88DU3 6.85e-177 499 67 3 382 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C4K3I5 6.81e-176 497 62 4 380 3 dnaJ Chaperone protein DnaJ Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C1DFM2 9.67e-176 496 67 3 381 3 dnaJ Chaperone protein DnaJ Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1STE5 7.04e-175 494 66 3 385 3 dnaJ Chaperone protein DnaJ Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B0KIS4 1.17e-174 494 66 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain GB-1)
Q9HV44 1.56e-174 493 65 1 379 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FR2 1.56e-174 493 65 1 379 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1H2 1.56e-174 493 65 1 379 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain LESB58)
A5W9A2 1.64e-174 493 66 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J255 2.02e-174 493 66 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain W619)
Q2SMM7 6.48e-173 489 65 3 380 3 dnaJ Chaperone protein DnaJ Hahella chejuensis (strain KCTC 2396)
A4SQ24 9.74e-173 489 70 2 382 3 dnaJ Chaperone protein DnaJ Aeromonas salmonicida (strain A449)
A6VNB0 2.22e-172 488 64 2 381 3 dnaJ Chaperone protein DnaJ Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6VCL7 5.09e-172 487 66 1 379 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain PA7)
Q1QSX1 2.54e-171 486 65 3 381 3 dnaJ Chaperone protein DnaJ Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VST5 1.25e-170 484 64 3 380 3 dnaJ Chaperone protein DnaJ Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B8F7S3 1.29e-170 484 66 2 381 3 dnaJ Chaperone protein DnaJ Glaesserella parasuis serovar 5 (strain SH0165)
P48208 1.37e-170 483 65 2 381 3 dnaJ Chaperone protein DnaJ Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1U613 1.52e-170 483 65 2 379 3 dnaJ Chaperone protein DnaJ Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P77866 1.73e-170 483 67 3 382 3 dnaJ Chaperone protein DnaJ Aggregatibacter actinomycetemcomitans
Q4KIH0 3.88e-170 482 65 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0BTI6 7.2e-170 482 64 1 381 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3J9 1.26e-169 481 64 1 381 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I3V1 3.09e-169 480 64 3 381 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 129Pt)
Q5P1H7 7.08e-169 479 62 2 376 3 dnaJ2 Chaperone protein DnaJ 2 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B0UWR3 1.23e-168 478 64 3 381 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 2336)
Q6VAY5 2.75e-168 478 65 3 381 3 dnaJ Chaperone protein DnaJ Stutzerimonas stutzeri
Q057X7 6.15e-168 477 54 2 389 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q48E63 7.5e-168 477 64 3 384 3 dnaJ Chaperone protein DnaJ Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C1DD87 8.65e-168 476 63 3 379 3 dnaJ Chaperone protein DnaJ Laribacter hongkongensis (strain HLHK9)
A4XYF5 9.73e-168 476 65 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas mendocina (strain ymp)
C3K274 4.3e-167 474 64 3 381 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain SBW25)
Q4ZNP8 3.33e-166 473 64 3 384 3 dnaJ Chaperone protein DnaJ Pseudomonas syringae pv. syringae (strain B728a)
B8GNX2 4.41e-165 469 61 3 380 3 dnaJ Chaperone protein DnaJ Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q87WP1 8.51e-164 466 65 3 384 3 dnaJ Chaperone protein DnaJ Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q21H37 1.19e-163 466 63 3 381 3 dnaJ Chaperone protein DnaJ Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q47XI7 2.05e-163 465 65 2 379 3 dnaJ Chaperone protein DnaJ Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8L3D3 2.98e-163 465 67 2 379 3 dnaJ Chaperone protein DnaJ Colwellia maris
P43735 7.52e-163 464 64 1 381 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5WV16 1.35e-161 461 60 3 382 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Lens)
P50025 1.41e-161 461 60 3 382 3 dnaJ Chaperone protein DnaJ Legionella pneumophila
Q5ZTY4 1.41e-161 461 60 3 382 3 dnaJ Chaperone protein DnaJ Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK7 1.41e-161 461 60 3 382 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Corby)
Q5X3M8 1.41e-161 461 60 3 382 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Paris)
A5UF67 2.4e-161 460 63 1 381 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain PittGG)
A6W2D1 7.04e-161 459 62 3 382 3 dnaJ Chaperone protein DnaJ Marinomonas sp. (strain MWYL1)
A9KG87 9.48e-161 458 59 3 377 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain Dugway 5J108-111)
B6J7U6 9.48e-161 458 59 3 377 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuK_Q154)
A1K4C4 1.08e-160 458 61 3 379 3 dnaJ Chaperone protein DnaJ Azoarcus sp. (strain BH72)
B6IZJ1 3.12e-159 454 59 4 377 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuG_Q212)
P42381 3.93e-159 454 59 4 377 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q1H3B9 4.98e-159 454 60 2 376 3 dnaJ Chaperone protein DnaJ Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A9N8H1 1.59e-158 453 59 4 377 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 331 / Henzerling II)
Q3SIN3 2.01e-158 452 63 4 378 3 dnaJ Chaperone protein DnaJ Thiobacillus denitrificans (strain ATCC 25259)
C5BQ32 4.72e-158 452 61 3 382 3 dnaJ Chaperone protein DnaJ Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0A7E4 6.87e-158 451 62 3 383 3 dnaJ Chaperone protein DnaJ Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9ZFC5 1.81e-157 450 61 5 379 3 dnaJ Chaperone protein DnaJ Methylovorus sp. (strain SS1 / DSM 11726)
Q3J7D9 3.56e-156 447 61 3 382 3 dnaJ Chaperone protein DnaJ Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7NXI1 3.89e-156 447 60 3 378 3 dnaJ Chaperone protein DnaJ Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q607A6 6.91e-155 444 62 3 380 3 dnaJ Chaperone protein DnaJ Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8XW41 4.08e-154 442 58 3 379 3 dnaJ Chaperone protein DnaJ Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0AIY0 5.07e-154 441 57 4 381 3 dnaJ Chaperone protein DnaJ Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q145F0 5.79e-154 441 57 3 387 3 dnaJ Chaperone protein DnaJ Paraburkholderia xenovorans (strain LB400)
A2SIR5 8.77e-154 441 56 6 383 3 dnaJ Chaperone protein DnaJ Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q5NSW9 1.41e-153 440 56 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia multivorans (strain ATCC 17616 / 249)
Q9PB06 2.21e-153 439 56 4 381 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain 9a5c)
B2SXC7 2.44e-153 440 57 3 386 3 dnaJ Chaperone protein DnaJ Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
O52065 4.7e-153 439 62 1 381 3 dnaJ Chaperone protein DnaJ Mannheimia haemolytica
Q39JC7 5.18e-153 439 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BYX2 6.73e-153 439 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain AU 1054)
B1JW20 6.73e-153 439 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain MC0-3)
B4EDZ1 6.73e-153 439 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4S9 6.73e-153 439 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain HI2424)
Q2KWA4 1.23e-152 438 58 2 376 3 dnaJ Chaperone protein DnaJ Bordetella avium (strain 197N)
Q0BI17 1.69e-152 437 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTK1 1.69e-152 437 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain MC40-6)
Q87BS9 2.24e-152 437 56 4 381 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6F5 2.24e-152 437 56 4 381 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M23)
A4JBS2 2.42e-152 437 56 3 385 3 dnaJ Chaperone protein DnaJ Burkholderia vietnamiensis (strain G4 / LMG 22486)
O06431 2.53e-152 437 57 4 379 3 dnaJ Chaperone protein DnaJ Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B0U3J7 2.79e-152 437 56 4 381 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M12)
Q7WGI5 4.71e-152 436 58 3 379 3 dnaJ Chaperone protein DnaJ Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W520 8.2e-152 436 58 3 379 3 dnaJ Chaperone protein DnaJ Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A3ND66 9.22e-152 436 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 668)
A3NYX5 9.22e-152 436 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1106a)
Q63R47 2.31e-151 435 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain K96243)
Q3JP12 2.31e-151 435 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1710b)
A9IGC5 2.43e-151 434 58 3 376 3 dnaJ Chaperone protein DnaJ Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1V0U8 5.91e-151 434 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain SAVP1)
Q62HD6 5.91e-151 434 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain ATCC 23344)
A2S563 5.91e-151 434 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10229)
A3MN97 5.91e-151 434 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10247)
Q46XI8 9.4e-151 433 56 2 379 3 dnaJ Chaperone protein DnaJ Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2SYZ3 1.27e-150 433 55 3 383 3 dnaJ Chaperone protein DnaJ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7VVY3 1.28e-150 433 58 3 385 3 dnaJ Chaperone protein DnaJ Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A5EYE5 1.52e-150 432 57 4 382 3 dnaJ Chaperone protein DnaJ Dichelobacter nodosus (strain VCS1703A)
B4SSQ7 1.53e-150 432 58 3 382 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain R551-3)
B2JGE1 4.37e-150 431 55 3 384 3 dnaJ Chaperone protein DnaJ Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1WAR7 8.48e-150 431 59 3 378 3 dnaJ Chaperone protein DnaJ Acidovorax sp. (strain JS42)
B2FMY6 1.98e-149 430 58 3 381 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain K279a)
B9MDJ8 3.55e-149 429 58 3 378 3 dnaJ Chaperone protein DnaJ Acidovorax ebreus (strain TPSY)
B3R6G6 1.18e-148 428 57 2 377 3 dnaJ Chaperone protein DnaJ Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B6IVA5 2.03e-147 425 56 4 381 3 dnaJ Chaperone protein DnaJ Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5H185 7e-147 423 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQU3 7e-147 423 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P458 7e-147 423 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q6F6R1 9.16e-147 423 59 6 382 3 dnaJ Chaperone protein DnaJ Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1WX30 1.2e-146 423 57 3 384 3 dnaJ Chaperone protein DnaJ Halorhodospira halophila (strain DSM 244 / SL1)
B1Y787 1.35e-146 423 56 3 385 3 dnaJ Chaperone protein DnaJ Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B0RVU1 2.11e-146 422 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain B100)
Q8PAK8 2.13e-146 422 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT12 2.13e-146 422 59 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain 8004)
Q1QET5 3.38e-146 422 59 2 379 3 dnaJ Chaperone protein DnaJ Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0K758 3.4e-146 422 56 3 381 3 dnaJ Chaperone protein DnaJ Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q4FVQ7 3.55e-146 421 58 3 382 3 dnaJ Chaperone protein DnaJ Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9BNG6 6.19e-146 421 56 4 385 3 dnaJ Chaperone protein DnaJ Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6RSN5 7.28e-146 421 57 4 382 1 dnaJ Chaperone protein DnaJ Rhizobium radiobacter
Q6G553 9.39e-146 421 53 5 382 3 dnaJ Chaperone protein DnaJ Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B2UBP2 2.11e-145 420 56 3 381 3 dnaJ Chaperone protein DnaJ Ralstonia pickettii (strain 12J)
Q3BVB7 6.01e-145 418 58 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMA9 8.71e-145 418 58 3 382 3 dnaJ Chaperone protein DnaJ Xanthomonas axonopodis pv. citri (strain 306)
C3MC05 8.86e-145 418 55 4 384 3 dnaJ Chaperone protein DnaJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6T225 1.02e-144 418 57 2 377 3 dnaJ Chaperone protein DnaJ Janthinobacterium sp. (strain Marseille)
P50018 1.06e-144 418 57 4 381 2 dnaJ Chaperone protein DnaJ Agrobacterium fabrum (strain C58 / ATCC 33970)
P48207 1.49e-144 417 55 6 384 3 dnaJ Chaperone protein DnaJ Francisella tularensis
Q2A327 1.49e-144 417 55 6 384 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. holarctica (strain LVS)
A4G8D1 2.35e-144 417 57 2 377 3 dnaJ Chaperone protein DnaJ Herminiimonas arsenicoxydans
A3PNM0 5.89e-144 416 54 5 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4IX29 9.14e-144 415 54 6 384 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain WY96-3418)
A1VMG1 1.06e-143 416 57 4 380 3 dnaJ Chaperone protein DnaJ Polaromonas naphthalenivorans (strain CJ2)
B9KPP3 1.69e-143 415 54 5 386 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q92T07 2.1e-143 415 55 4 384 3 dnaJ Chaperone protein DnaJ Rhizobium meliloti (strain 1021)
Q3IYM8 2.49e-143 414 54 5 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2KDW7 2.83e-143 414 57 4 382 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1LJ82 2.98e-143 414 57 3 379 3 dnaJ Chaperone protein DnaJ Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1KR91 4.09e-143 414 58 3 378 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P63969 4.09e-143 414 58 3 378 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63968 4.09e-143 414 58 3 378 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZV9 4.09e-143 414 58 3 378 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C (strain 053442)
A5CX57 7.52e-143 413 54 4 378 3 dnaJ Chaperone protein DnaJ Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B3PXH2 7.56e-143 413 57 4 382 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain CIAT 652)
Q6G1F8 1.15e-142 413 52 5 382 3 dnaJ Chaperone protein DnaJ Bartonella quintana (strain Toulouse)
Q1MN12 1.25e-142 412 57 4 382 3 dnaJ Chaperone protein DnaJ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q128K1 1.44e-142 412 57 3 379 3 dnaJ Chaperone protein DnaJ Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6UEY1 3.52e-142 411 55 5 384 3 dnaJ Chaperone protein DnaJ Sinorhizobium medicae (strain WSM419)
B5ZWQ1 5.01e-142 411 57 4 382 3 dnaJ Chaperone protein DnaJ Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A4WW88 8.17e-142 410 55 4 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A5WBF8 1.37e-141 410 57 2 378 3 dnaJ Chaperone protein DnaJ Psychrobacter sp. (strain PRwf-1)
Q5F5M1 9.59e-141 407 57 3 378 3 dnaJ Chaperone protein DnaJ Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5NFG8 5.45e-140 406 55 5 383 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GX0 5.45e-140 406 55 5 383 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain FSC 198)
Q31HA6 8.87e-140 405 55 1 376 3 dnaJ Chaperone protein DnaJ Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B0TYF3 3.26e-139 404 54 5 383 3 dnaJ Chaperone protein DnaJ Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q98DD2 9.32e-139 403 53 5 382 3 dnaJ Chaperone protein DnaJ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B9JGW2 1.73e-138 402 55 3 385 3 dnaJ Chaperone protein DnaJ Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B2IBR5 3.83e-138 401 52 6 383 3 dnaJ Chaperone protein DnaJ Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q11KJ5 1.39e-137 400 53 5 381 3 dnaJ Chaperone protein DnaJ Chelativorans sp. (strain BNC1)
B0VA24 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AYE)
A3MA88 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ00 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain SDF)
B2I2G6 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ACICU)
B7I2B2 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB0057)
B7GV08 2.9e-137 399 57 5 380 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB307-0294)
A1AW21 1.54e-136 397 53 3 377 3 dnaJ Chaperone protein DnaJ Ruthia magnifica subsp. Calyptogena magnifica
A1TLH8 1.68e-136 397 56 4 379 3 dnaJ Chaperone protein DnaJ Paracidovorax citrulli (strain AAC00-1)
B9JZ89 6.04e-136 395 53 5 390 3 dnaJ Chaperone protein DnaJ Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B8IHL2 8.1e-136 395 54 4 391 3 dnaJ Chaperone protein DnaJ Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A6WX07 8.53e-136 395 56 4 380 3 dnaJ Chaperone protein DnaJ Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FXX1 2.09e-135 394 57 4 378 3 dnaJ Chaperone protein DnaJ Brucella suis biovar 1 (strain 1330)
B0CJX5 2.09e-135 394 57 4 378 3 dnaJ Chaperone protein DnaJ Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YE77 2.09e-135 394 57 4 378 3 dnaJ Chaperone protein DnaJ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG11 2.09e-135 394 57 4 378 3 dnaJ Chaperone protein DnaJ Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9V9 2.09e-135 394 57 4 378 3 dnaJ Chaperone protein DnaJ Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q16D44 3.88e-135 394 55 4 372 3 dnaJ Chaperone protein DnaJ Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q57AD6 7.16e-135 393 56 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus biovar 1 (strain 9-941)
Q2YQV1 7.16e-135 393 56 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus (strain 2308)
B2S9C2 7.16e-135 393 56 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus (strain S19)
Q1GKS4 2.04e-134 392 52 4 388 3 dnaJ Chaperone protein DnaJ Ruegeria sp. (strain TM1040)
Q05980 2.25e-134 392 56 4 378 2 dnaJ Chaperone protein DnaJ Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B0U833 2.83e-134 392 53 4 392 3 dnaJ Chaperone protein DnaJ Methylobacterium sp. (strain 4-46)
Q2VYT0 2.91e-134 392 55 3 381 3 dnaJ Chaperone protein DnaJ Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5LWJ5 3.53e-134 391 53 4 384 3 dnaJ Chaperone protein DnaJ Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A8IPT0 5.01e-134 391 52 5 383 3 dnaJ Chaperone protein DnaJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B1LZ52 9.62e-134 390 54 4 382 3 dnaJ Chaperone protein DnaJ Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B5ENA2 1.84e-133 389 56 3 380 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7X8 1.84e-133 389 56 3 380 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q52702 4.7e-133 389 52 5 389 3 dnaJ Chaperone protein DnaJ Rhodobacter capsulatus
Q28VY4 2.66e-132 387 51 5 388 3 dnaJ Chaperone protein DnaJ Jannaschia sp. (strain CCS1)
A7HZ38 4.64e-132 386 52 4 385 3 dnaJ Chaperone protein DnaJ Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9W6R8 4.69e-132 386 51 4 389 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain PA1)
B1ZGR2 9.51e-132 385 51 4 387 3 dnaJ Chaperone protein DnaJ Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A1B4F0 2.48e-131 384 52 6 388 3 dnaJ Chaperone protein DnaJ Paracoccus denitrificans (strain Pd 1222)
A7IC67 4.36e-131 383 52 4 382 3 dnaJ Chaperone protein DnaJ Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P22305 7.23e-131 383 50 3 386 3 dnaJ Chaperone protein DnaJ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B7KSZ5 7.48e-131 383 51 4 389 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8LQ63 1.76e-129 379 51 4 387 3 dnaJ Chaperone protein DnaJ Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2J319 1.45e-128 377 53 4 376 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain HaA2)
Q21CI1 5.86e-128 375 52 3 375 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain BisB18)
Q5NPS5 1.38e-127 374 52 5 379 3 dnaJ Chaperone protein DnaJ Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
O08356 8.01e-127 372 53 4 376 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas sp. (strain No.7)
B3Q973 8.01e-127 372 53 4 376 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain TIE-1)
Q6NCY3 8.01e-127 372 53 4 376 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q93S23 1.73e-126 370 58 3 331 3 dnaJ Chaperone protein DnaJ (Fragment) Rhizobium tropici
Q75WD2 2.14e-126 371 54 5 379 3 dnaJ Chaperone protein DnaJ Acetobacter pasteurianus (strain NBRC 105184 / IFO 3283-01)
C5D4U0 1.75e-123 364 53 6 382 3 dnaJ Chaperone protein DnaJ Geobacillus sp. (strain WCH70)
Q1RHG9 3.36e-123 363 48 5 379 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain RML369-C)
Q9ZDY0 5.06e-123 362 48 7 377 3 dnaJ Chaperone protein DnaJ Rickettsia prowazekii (strain Madrid E)
A8GV67 5.2e-123 363 48 5 379 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain OSU 85-389)
Q3A8C3 9.55e-123 362 51 3 377 3 dnaJ Chaperone protein DnaJ Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q74H58 1.14e-122 362 53 2 374 3 dnaJ Chaperone protein DnaJ Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q4FNQ0 1.65e-122 361 51 5 382 3 dnaJ Chaperone protein DnaJ Pelagibacter ubique (strain HTCC1062)
Q0C454 4.82e-122 360 52 5 383 3 dnaJ Chaperone protein DnaJ Hyphomonas neptunium (strain ATCC 15444)
A8GMF8 5.1e-122 360 50 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia akari (strain Hartford)
Q9KWS6 7.19e-122 360 53 6 382 3 dnaJ Chaperone protein DnaJ Parageobacillus thermoglucosidasius
Q68XI3 9.91e-122 359 47 7 377 3 dnaJ Chaperone protein DnaJ Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q24SS4 2.28e-121 358 52 5 380 3 dnaJ Chaperone protein DnaJ Desulfitobacterium hafniense (strain Y51)
B8FUN3 2.28e-121 358 52 5 380 3 dnaJ Chaperone protein DnaJ Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q0AKB3 3.78e-121 358 51 4 390 3 dnaJ Chaperone protein DnaJ Maricaulis maris (strain MCS10)
P94319 8.88e-121 357 52 4 376 3 dnaJ Chaperone protein DnaJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8EXP6 2.9e-120 355 45 5 378 3 dnaJ Chaperone protein DnaJ Rickettsia canadensis (strain McKiel)
Q92J37 4.25e-120 355 48 7 379 3 dnaJ Chaperone protein DnaJ Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PMM6 4.25e-120 355 48 7 379 3 dnaJ Chaperone protein DnaJ Rickettsia africae (strain ESF-5)
B8CXL0 9.41e-120 354 51 5 379 3 dnaJ Chaperone protein DnaJ Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B8I304 9.74e-120 354 51 5 381 3 dnaJ Chaperone protein DnaJ Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
C4K111 1.75e-119 353 48 7 379 3 dnaJ Chaperone protein DnaJ Rickettsia peacockii (strain Rustic)
A8F0U0 1.87e-119 353 48 7 382 3 dnaJ Chaperone protein DnaJ Rickettsia massiliae (strain Mtu5)
Q8RB67 2.6e-119 353 51 5 386 3 dnaJ Chaperone protein DnaJ Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B0BWH0 2.95e-119 353 48 7 379 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Iowa)
A8GR21 1.23e-118 352 48 7 379 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Sheila Smith)
A0LJ41 3.91e-118 350 49 3 370 3 dnaJ Chaperone protein DnaJ Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A4IR30 4.12e-118 350 52 6 382 3 dnaJ Chaperone protein DnaJ Geobacillus thermodenitrificans (strain NG80-2)
Q5KWZ8 5.53e-118 350 53 5 382 3 dnaJ Chaperone protein DnaJ Geobacillus kaustophilus (strain HTA426)
Q9LCQ4 1e-117 349 50 7 380 3 dnaJ Chaperone protein DnaJ Brevibacillus choshinensis
B0SRF0 3.4e-117 348 50 7 383 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHT0 3.4e-117 348 50 7 383 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q4UJK6 1.38e-116 346 47 7 377 3 dnaJ Chaperone protein DnaJ Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A7GT07 8.13e-116 344 52 7 380 3 dnaJ Chaperone protein DnaJ Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2GLU9 1.86e-115 343 47 6 386 3 dnaJ Chaperone protein DnaJ Anaplasma phagocytophilum (strain HZ)
A4XKA5 2.61e-115 343 49 6 387 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MJZ0 6.23e-115 342 50 6 388 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q182E7 9.74e-115 342 49 4 388 3 dnaJ Chaperone protein DnaJ Clostridioides difficile (strain 630)
Q5FSL4 1.35e-114 341 51 4 375 3 dnaJ Chaperone protein DnaJ Gluconobacter oxydans (strain 621H)
Q2GI75 3.4e-114 340 48 5 387 3 dnaJ Chaperone protein DnaJ Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A7Z6W0 4e-114 340 52 6 383 3 dnaJ Chaperone protein DnaJ Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1ZUS0 7.2e-114 340 50 3 386 3 dnaJ Chaperone protein DnaJ Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A3DF24 8.12e-114 340 50 5 384 3 dnaJ Chaperone protein DnaJ Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q6AN63 1.05e-113 339 47 4 381 3 dnaJ Chaperone protein DnaJ Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A5CD86 1.41e-113 338 46 4 374 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Boryong)
A8FFD1 2.81e-113 338 51 5 382 3 dnaJ Chaperone protein DnaJ Bacillus pumilus (strain SAFR-032)
Q65H55 7.07e-113 337 52 6 383 3 dnaJ Chaperone protein DnaJ Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B1HUD0 1.45e-112 336 50 6 382 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus (strain C3-41)
P61441 1.48e-112 336 48 7 375 3 dnaJ Chaperone protein DnaJ Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P61440 1.48e-112 336 48 7 375 3 dnaJ Chaperone protein DnaJ Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B3CVD9 1.67e-112 336 45 4 374 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Ikeda)
Q3YT99 1.8e-112 336 47 6 386 3 dnaJ Chaperone protein DnaJ Ehrlichia canis (strain Jake)
Q5P9E0 1.9e-112 336 44 6 387 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain St. Maries)
B9KH92 1.9e-112 336 44 6 387 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain Florida)
A9KKT9 6.36e-112 335 49 4 362 3 dnaJ Chaperone protein DnaJ Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8CXD3 6.86e-112 334 51 5 357 3 dnaJ Chaperone protein DnaJ Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5HCG4 7.32e-112 335 46 4 384 3 dnaJ Chaperone protein DnaJ Ehrlichia ruminantium (strain Welgevonden)
A0Q1R3 8.34e-112 334 51 3 359 3 dnaJ Chaperone protein DnaJ Clostridium novyi (strain NT)
Q5FGQ8 2.08e-111 333 46 4 384 3 dnaJ Chaperone protein DnaJ Ehrlichia ruminantium (strain Gardel)
Q5WHG0 4.36e-111 332 50 6 382 3 dnaJ Chaperone protein DnaJ Shouchella clausii (strain KSM-K16)
A5FZ18 5.53e-111 332 52 4 385 3 dnaJ Chaperone protein DnaJ Acidiphilium cryptum (strain JF-5)
P17631 5.84e-111 332 51 6 383 2 dnaJ Chaperone protein DnaJ Bacillus subtilis (strain 168)
B1YKT0 8.19e-111 331 50 4 360 3 dnaJ Chaperone protein DnaJ Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q316U7 1.39e-110 331 48 0 349 3 dnaJ Chaperone protein DnaJ Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5L6F7 1.63e-110 331 46 5 394 3 dnaJ Chaperone protein DnaJ Chlamydia abortus (strain DSM 27085 / S26/3)
Q8RH03 5.57e-110 330 48 5 370 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q892R1 3.12e-109 327 47 5 384 3 dnaJ Chaperone protein DnaJ Clostridium tetani (strain Massachusetts / E88)
Q70WY6 3.81e-109 328 45 7 400 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. polymorphum
O69269 4.1e-109 327 50 7 382 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus
Q8TQR1 6.96e-109 327 48 5 352 3 dnaJ Chaperone protein DnaJ Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8XIT1 8.82e-109 327 51 4 372 3 dnaJ Chaperone protein DnaJ Clostridium perfringens (strain 13 / Type A)
Q67S53 1.87e-108 326 49 5 383 3 dnaJ Chaperone protein DnaJ Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9E6X0 2.72e-108 325 50 7 381 3 dnaJ Chaperone protein DnaJ Macrococcus caseolyticus (strain JCSC5402)
O27352 4.52e-108 325 47 8 385 3 dnaJ Chaperone protein DnaJ Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P0CW06 5.65e-108 325 48 5 352 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei
P0CW07 5.65e-108 325 48 5 352 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q634M8 1.06e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ZK / E33L)
C1ESK7 1.06e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain 03BB102)
B9IY80 1.2e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain Q1)
B7HPL2 1.2e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain AH187)
Q730M2 1.2e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HDK8 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HCT9 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain B4264)
B7IYG6 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain G9842)
Q81LS3 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus anthracis
C3L5R6 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8L9 1.22e-107 323 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus anthracis (strain A0248)
B8DQW8 2.66e-107 323 49 4 358 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q9KD71 3.17e-107 322 51 5 380 3 dnaJ Chaperone protein DnaJ Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7JN38 6.08e-107 322 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain AH820)
A1V9Q3 1.16e-106 321 48 2 352 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DP4)
Q725M6 1.16e-106 321 48 2 352 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A9VHU0 3.21e-106 320 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus mycoides (strain KBAB4)
Q818F0 4.34e-106 319 51 5 377 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A5N6M3 4.98e-106 320 49 3 357 3 dnaJ Chaperone protein DnaJ Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q73Q15 7.05e-106 319 46 6 374 3 dnaJ Chaperone protein DnaJ Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
C0ZB49 1.33e-105 318 48 6 380 3 dnaJ Chaperone protein DnaJ Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P30725 1.58e-105 318 47 3 375 2 dnaJ Chaperone protein DnaJ Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6LRN5 1.63e-105 318 46 3 376 3 dnaJ Chaperone protein DnaJ Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q6MNG0 2.78e-105 317 46 3 361 3 dnaJ Chaperone protein DnaJ Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8DWH2 3.68e-105 317 48 5 384 3 dnaJ Chaperone protein DnaJ Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A9HEA1 8.79e-105 316 52 5 378 3 dnaJ Chaperone protein DnaJ Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5M6D0 9.57e-105 316 48 6 385 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1T7 9.57e-105 316 48 6 385 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain CNRZ 1066)
A0AIS3 1.61e-104 315 49 6 383 3 dnaJ Chaperone protein DnaJ Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8CP18 2.14e-104 315 47 6 382 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q253T6 3.09e-104 315 45 3 393 3 dnaJ Chaperone protein DnaJ Chlamydia felis (strain Fe/C-56)
Q6GGC1 3.12e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MRSA252)
P0DJM1 4.42e-104 315 50 5 382 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
G2K045 4.42e-104 315 50 5 382 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 1/2a (strain 10403S)
P63972 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MW2)
A8Z4B8 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8Y8 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MSSA476)
P63971 4.71e-104 315 47 6 381 1 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain N315)
P63970 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHC2 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Newman)
Q5HFI1 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain COL)
A5ITA7 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH9)
Q2FXZ3 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGE4 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300)
A6U251 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH1)
A7X2Y0 4.71e-104 315 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YT48 4.92e-104 314 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q73IV4 5.33e-104 314 47 5 351 3 dnaJ Chaperone protein DnaJ Wolbachia pipientis wMel
Q5HNW7 1.2e-103 313 46 6 382 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9UXR9 1.23e-103 314 44 8 392 3 dnaJ Chaperone protein DnaJ Methanosarcina thermophila
Q6ME07 3.45e-103 312 45 3 385 3 dnaJ Chaperone protein DnaJ Protochlamydia amoebophila (strain UWE25)
Q835R5 4.57e-103 312 47 5 386 3 dnaJ Chaperone protein DnaJ Enterococcus faecalis (strain ATCC 700802 / V583)
Q71ZJ8 9.98e-103 311 49 6 383 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain F2365)
C1KVB9 9.98e-103 311 49 6 383 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DE39 1.09e-102 311 49 6 383 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4a (strain HCC23)
Q92BN9 1.09e-102 311 49 6 383 3 dnaJ Chaperone protein DnaJ Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A5UYW4 1.82e-102 310 44 4 357 3 dnaJ Chaperone protein DnaJ Roseiflexus sp. (strain RS-1)
C4L424 2.72e-102 310 51 8 379 3 dnaJ Chaperone protein DnaJ Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q823T2 7.48e-102 309 44 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P45555 9.01e-102 308 47 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus
C6BYN5 1.41e-101 308 45 2 354 3 dnaJ Chaperone protein DnaJ Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q9Z9E9 3.06e-101 308 43 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia pneumoniae
O87778 1.64e-100 305 47 5 378 2 dnaJ Chaperone protein DnaJ Latilactobacillus sakei
Q49Y21 1.76e-100 305 46 6 382 3 dnaJ Chaperone protein DnaJ Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q38W94 1.91e-100 305 47 5 378 3 dnaJ Chaperone protein DnaJ Latilactobacillus sakei subsp. sakei (strain 23K)
Q3AF07 3.3e-100 305 48 5 364 3 dnaJ Chaperone protein DnaJ Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7UM96 3.96e-100 305 45 6 389 3 dnaJ Chaperone protein DnaJ Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8DKR7 4.86e-100 304 46 4 351 3 dnaJ Chaperone protein DnaJ Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q74IT7 1.02e-99 304 45 6 389 3 dnaJ Chaperone protein DnaJ Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q044A8 1.18e-99 303 45 6 389 3 dnaJ Chaperone protein DnaJ Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B2TLZ8 2.17e-99 302 45 4 381 3 dnaJ Chaperone protein DnaJ Clostridium botulinum (strain Eklund 17B / Type B)
Q3K3T1 2.59e-99 302 47 6 382 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B2V2I6 2.72e-99 302 45 4 381 3 dnaJ Chaperone protein DnaJ Clostridium botulinum (strain Alaska E43 / Type E3)
Q84BU3 4.73e-99 302 47 7 384 3 dnaJ Chaperone protein DnaJ Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q93R26 5.5e-99 302 47 7 386 3 dnaJ Chaperone protein DnaJ Tetragenococcus halophilus
A7NS65 7.57e-99 301 41 5 377 3 dnaJ Chaperone protein DnaJ Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8E298 8.93e-99 301 48 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q1G9R3 9.96e-99 301 46 6 380 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q8E7Q7 1.17e-98 301 48 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype III (strain NEM316)
Q049W7 1.26e-98 300 46 6 380 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B5YAR4 1.84e-98 300 48 10 394 3 dnaJ Chaperone protein DnaJ Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B9DNJ9 2.62e-98 300 45 6 381 3 dnaJ Chaperone protein DnaJ Staphylococcus carnosus (strain TM300)
O33529 3.52e-96 289 62 2 237 3 dnaJ Chaperone protein DnaJ (Fragment) Rhizobium leguminosarum
Q6A662 5.01e-96 294 43 7 369 3 dnaJ2 Chaperone protein DnaJ 2 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q45552 5.4e-96 294 46 10 391 3 dnaJ Chaperone protein DnaJ Geobacillus stearothermophilus
A1BHL1 7.63e-96 294 40 5 398 3 dnaJ Chaperone protein DnaJ Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B9DVF2 7.75e-96 293 47 5 384 3 dnaJ Chaperone protein DnaJ Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B0S1F7 7.97e-96 293 40 5 384 3 dnaJ Chaperone protein DnaJ Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B0CAZ0 1.66e-95 292 43 7 364 3 dnaJ Chaperone protein DnaJ Acaryochloris marina (strain MBIC 11017)
C0R562 2.63e-95 292 47 5 351 3 dnaJ Chaperone protein DnaJ Wolbachia sp. subsp. Drosophila simulans (strain wRi)
P0C0B5 3.61e-95 292 48 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes
Q8L397 5.57e-95 291 42 5 383 3 dnaJ Chaperone protein DnaJ Acholeplasma laidlawii
Q8NZM7 5.62e-95 291 47 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XAD7 5.62e-95 291 47 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA71 6.13e-95 291 47 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA70 6.13e-95 291 47 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0B6 6.13e-95 291 47 4 383 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M1
B3CP03 9.03e-95 290 47 5 351 3 dnaJ Chaperone protein DnaJ Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q5YNI2 1.34e-94 290 44 3 364 3 dnaJ2 Chaperone protein DnaJ 2 Nocardia farcinica (strain IFM 10152)
Q02VR5 2.2e-94 290 46 6 384 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. cremoris (strain SK11)
Q8NLY8 2.24e-94 290 42 6 376 3 dnaJ2 Chaperone protein DnaJ 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A2RP20 4.12e-94 289 46 6 384 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. cremoris (strain MG1363)
B2G6W4 4.87e-94 289 45 6 388 3 dnaJ Chaperone protein DnaJ Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJE8 4.87e-94 289 45 6 388 3 dnaJ Chaperone protein DnaJ Limosilactobacillus reuteri (strain DSM 20016)
Q5GRK1 6.83e-94 288 47 6 352 3 dnaJ Chaperone protein DnaJ Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q03FR6 1.25e-93 288 47 6 376 3 dnaJ Chaperone protein DnaJ Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q93Q66 2.07e-93 287 46 4 362 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. cremoris
C4Z1J3 2.29e-93 287 46 3 363 3 dnaJ Chaperone protein DnaJ Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
P95830 9.64e-93 285 45 3 381 1 dnaJ Chaperone protein DnaJ Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q114R3 1.55e-92 285 42 8 360 3 dnaJ Chaperone protein DnaJ Trichodesmium erythraeum (strain IMS101)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07395
Feature type CDS
Gene dnaJ
Product molecular chaperone DnaJ
Location 79870 - 81015 (strand: 1)
Length 1146 (nucleotides) / 381 (amino acids)

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_182
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00226 DnaJ domain
PF00684 DnaJ central domain
PF01556 DnaJ C terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0484 Posttranslational modification, protein turnover, chaperones (O) O DnaJ-class molecular chaperone with C-terminal Zn finger domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03686 molecular chaperone DnaJ - -

Protein Sequence

MAKKDYYEVLGVSKSADDKEIKKAYKRLAMKYHPDRNQGDKDAEDKFKEVKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGGFGGGGFGGADFGDIFGDVFGDIFGGGRRQQRAARGADLRYNIELTLEEAVRGVTKEIRIPTLETCDKCHGSGAKEGTEPQECPTCHGMGQVQMRQGFFAVQQACPTCHGRGKIIKDPCSKCHGHGRVERYKTLSVKIPAGMDSGDRIRLTGEGEAGEMGAPAGDLYVEVHVRQHNIFERDGSNLYCEVPIGFTVAALGGEIEVPTLDGRVKLKIPAETQTGKLFRMKGKGVRPARGGMQGDLMCRVVVETPVKLSEKQKELLREFGESVDGQSGHNNTPKAKRFFDGVKKFFDDLTK

Flanking regions ( +/- flanking 50bp)

GGCGTTGAGGAAACTCTGCGCCCGTGTGCTTGTGTTAAGGGACAAAACGGATGGCAAAAAAAGATTACTACGAGGTGTTGGGCGTCTCGAAATCTGCGGATGACAAAGAGATTAAAAAAGCCTACAAACGCCTTGCGATGAAATATCACCCTGACCGTAATCAGGGCGATAAAGACGCGGAAGATAAATTCAAAGAAGTAAAAGAAGCATACGAGATCCTCACCGACGCACAGAAACGTGCGGCTTATGACCAGTACGGCCACGCGGCATTTGAGCAGGGCGGTATGGGCGGTGGCGGCGGATTTGGCGGCGGCGGTTTCGGCGGTGCTGATTTCGGTGATATCTTTGGTGACGTCTTCGGTGATATTTTTGGTGGTGGTCGCCGTCAGCAACGCGCGGCACGCGGAGCAGACCTGCGTTACAACATCGAACTGACCCTTGAAGAAGCGGTTCGTGGTGTGACCAAAGAGATCCGTATTCCGACCCTGGAAACCTGTGATAAATGTCACGGCAGCGGGGCGAAAGAAGGTACAGAGCCGCAGGAGTGTCCGACCTGTCACGGTATGGGCCAGGTGCAGATGCGCCAGGGCTTCTTTGCGGTGCAGCAGGCGTGTCCGACCTGTCACGGCCGCGGCAAAATCATCAAAGATCCGTGCAGCAAATGTCATGGTCACGGGCGTGTTGAACGCTATAAGACCCTGTCAGTCAAAATCCCTGCGGGGATGGACAGCGGTGACCGTATCCGTCTGACCGGCGAAGGTGAAGCAGGCGAAATGGGGGCTCCGGCAGGCGATCTGTATGTCGAGGTTCATGTCCGCCAGCACAATATCTTCGAGCGTGACGGCAGCAATCTCTACTGTGAAGTGCCGATTGGCTTTACGGTTGCGGCGCTGGGCGGTGAAATTGAAGTACCGACACTGGACGGGCGCGTTAAGCTGAAAATCCCGGCAGAAACCCAGACCGGCAAGCTGTTCCGCATGAAAGGCAAAGGTGTCAGACCGGCGCGCGGCGGAATGCAGGGTGACCTGATGTGCCGTGTGGTGGTGGAAACCCCGGTGAAACTGAGCGAAAAACAGAAAGAACTGTTACGTGAGTTCGGTGAATCTGTGGATGGCCAGAGCGGTCACAACAACACCCCGAAAGCAAAACGCTTCTTTGACGGTGTGAAAAAATTCTTTGATGACCTGACCAAATAAGCCATTGTCAGATATGTATATAACCGGCCGGGATAATTTTCCCGGCCGGT