Homologs in group_1784

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13010 FBDBKF_13010 100.0 Morganella morganii S1 cueR Cu(I)-responsive transcriptional regulator
EHELCC_06325 EHELCC_06325 100.0 Morganella morganii S2 cueR Cu(I)-responsive transcriptional regulator
NLDBIP_06645 NLDBIP_06645 100.0 Morganella morganii S4 cueR Cu(I)-responsive transcriptional regulator
LHKJJB_03525 LHKJJB_03525 100.0 Morganella morganii S3 cueR Cu(I)-responsive transcriptional regulator
F4V73_RS16195 F4V73_RS16195 92.8 Morganella psychrotolerans cueR Cu(I)-responsive transcriptional regulator
PMI_RS10705 PMI_RS10705 74.2 Proteus mirabilis HI4320 cueR Cu(I)-responsive transcriptional regulator

Distribution of the homologs in the orthogroup group_1784

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1784

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q93CH6 4.69e-65 197 67 0 133 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z8S3 5.01e-65 197 66 0 133 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q8ZCA8 2.74e-64 195 67 0 132 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
P0A9G5 5.63e-61 186 63 0 133 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 5.63e-61 186 63 0 133 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8XD09 1.74e-60 185 63 0 133 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
Q8FK74 1.94e-60 185 63 0 133 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C6D2 5.17e-41 136 46 1 135 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 5.17e-41 136 46 1 135 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9HV30 3.85e-33 116 41 1 132 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X5V4 5.79e-31 110 41 1 127 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P58379 2.81e-27 101 35 0 127 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q9X5X4 1.87e-25 97 33 0 127 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P44617 5.57e-25 95 37 0 128 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P58378 2.96e-24 94 32 1 134 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
P22853 1.06e-22 89 37 1 125 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P22874 1.2e-19 82 33 1 129 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
P0ACS5 3.36e-18 78 31 3 138 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 3.36e-18 78 31 3 138 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
Q55963 1.58e-16 73 29 0 112 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P45277 1.59e-13 66 26 0 130 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22896 3.77e-13 64 30 0 113 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P13111 2.57e-11 60 27 2 136 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P0A2Q9 9.86e-11 58 27 2 129 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 9.86e-11 58 27 2 129 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
P69413 1.8e-10 58 27 2 129 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 1.8e-10 58 27 2 129 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 1.8e-10 58 27 2 129 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
O06474 8.37e-10 56 39 1 73 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
O06008 6.18e-09 54 29 2 111 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P37510 1.37e-08 53 31 0 85 4 yyaN Uncharacterized HTH-type transcriptional regulator YyaN Bacillus subtilis (strain 168)
P50329 6.83e-07 49 27 2 109 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
P0A4T9 2e-06 48 27 1 105 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2e-06 48 27 1 105 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P50330 5.45e-06 47 26 2 109 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P22537 1.18e-05 46 28 2 107 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P71039 2.19e-05 45 26 1 110 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P44558 0.00045 41 29 1 85 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07000
Feature type CDS
Gene cueR
Product Cu(I)-responsive transcriptional regulator
Location 217318 - 217734 (strand: -1)
Length 417 (nucleotides) / 138 (amino acids)

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1784
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19591 MerR family transcriptional regulator, copper efflux regulator - Multidrug resistance, efflux pump MexPQ-OpmE

Protein Sequence

MNISDIAQKTGLTPKAIRFYEDKSLITPPERGENGYRYFSERHVDELTLLRQAKEVGFTLDECRELLSLFRNPNRHAADVKSATLGKVKQIEKTITELTAIRDRLLALADSCPGDDSAECPIIDHLSGCRHSKPACHK

Flanking regions ( +/- flanking 50bp)

ATTTACGATGATGGTAAACCTTCCCTCAAGGGTAAGGTCAAGGAGAAGTTATGAATATCAGCGATATTGCACAAAAAACGGGTTTAACACCAAAAGCGATCCGTTTTTACGAAGATAAATCTTTGATCACGCCACCGGAACGGGGTGAGAACGGATACCGGTATTTCAGTGAACGGCATGTGGATGAACTGACCCTGCTGCGTCAGGCAAAAGAGGTCGGGTTCACGCTGGATGAGTGCCGCGAGCTGTTATCGCTGTTCCGTAATCCGAACCGCCACGCGGCGGATGTGAAATCGGCGACACTGGGCAAAGTGAAGCAGATTGAGAAAACCATTACGGAGCTCACGGCTATCCGTGACCGCCTGCTGGCACTGGCTGATTCCTGTCCCGGGGATGACAGCGCGGAGTGTCCGATCATCGATCATCTCTCCGGATGCCGCCACAGCAAACCTGCCTGCCATAAATAATCCGTCTGTTTTGTGCGTCTGCCCGCCGGGCAGACGCCGTCTTACATCCT